ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

995

Name

CDC25C

Synonym

CDC25|PPP1R60;cell division cycle 25C;CDC25C;cell division cycle 25C

Definition

M-phase inducer phosphatase 3|dual specificity phosphatase CDC25C|mitosis inducer CDC25|phosphotyrosine phosphatase|protein phosphatase 1, regulatory subunit 60

Position

5q31

Gene Type

protein-coding

Pathways and Diseases

Pathway

G2/M Transition;PID Reactome;500378

Pathway

Cell Cycle, Mitotic;Reactome;REACT:152

Pathway

p53 pathway;PANTHER;P00059

Pathway

Activation of ATR in response to replication stress;PID Reactome;500319

Pathway

PLK3 signaling events;PID Curated;200186

Pathway

Chk1/Chk2(Cds1) mediated inactivation of Cyclin B:Cdk1 complex;PID Reactome;500318

Pathway

Progesterone-mediated oocyte maturation;KEGG PATHWAY;hsa04914

Pathway

Cell Cycle Checkpoints;Reactome;REACT:1538

Pathway

how progesterone initiates the oocyte maturation;PID BioCarta;100104

Pathway

Oocyte meiosis;KEGG PATHWAY;hsa04114

Pathway

Cell cycle;KEGG PATHWAY;hsa04110

Pathway

Cyclin A/B1 associated events during G2/M transition;PID Reactome;500991

Pathway

PLK1 signaling events;PID Curated;200087

Pathway

Polo-like kinase mediated events;PID Reactome;500379

External Links

Links to cell senescence gene database

995

Links to epithelial mesenchymal transition gene database

995

Links to ovarian cancer gene database

995

Links to endometrial cancer gene database

995

Links to iHOP

995

Sequence Information

Nucleotide Sequence

>995 : length: 2304
GAGGTGCCCGCCCCGAGGCCCCAGCGCCACCTGCCCTCCACCACCTACCGCGGTTCCTCC
AGCTCCCAGGGCCGCGGCCGGAGCAGCTCTGAGCGCTCGGTTCGCCCCACGGTGCCCTTA
AAAGGCGCTGGCGCGAACCAACGAGTCCCTGAGGAGAGTAGGGGGACAGCTCCGGCTCGC
AGAATCCCCCCAAGCCACCCATGGAGGGCGCAGCTCCGTGTCGTGTCTCTCTCAAAGTGT
CTCTCGGACAGCGCTGTTGGGAACGAGCCTGGCGCTTTGATTTAGGGATGGGGGTGGTTT
CCTCACTAACGAGTCACCCCCTCCAAAATATCGCAGAAAGTGGACGGCCCCAGTTGGAGG
CACATCTTGAAACCCGCGGGGGAGGCCATGTCGGAAGAAGGTTTTGTTTTTCTCCTGGTG
AGAATTCGAAGACCATGTCTACGGAACTCTTCTCATCCACAAGAGAGGAAGGAAGCTCTG
GCTCAGGACCCAGTTTTAGGTCTAATCAAAGGAAAATGTTAAACCTGCTCCTGGAGAGAG
ACACTTCCTTTACCGTCTGTCCAGATGTCCCTAGAACTCCAGTGGGCAAATTTCTTGGTG
ATTCTGCAAACCTAAGCATTTTGTCTGGAGGAACCCCAAAACGTTGCCTCGATCTTTCGA
ATCTTAGCAGTGGGGAGATAACTGCCACTCAGCTTACCACTTCTGCAGACCTTGATGAAA
CTGGTCACCTGGATTCTTCAGGACTTCAGGAAGTGCATTTAGCTGGGATGAATCATGACC
AGCACCTAATGAAATGTAGCCCAGCACAGCTTCTTTGTAGCACTCCGAATGGTTTGGACC
GTGGCCATAGAAAGAGAGATGCAATGTGTAGTTCATCTGCAAATAAAGAAAATGACAATG
GAAACTTGGTGGACAGTGAAATGAAATATTTGGGCAGTCCCATTACTACTGTTCCAAAAT
TGGATAAAAATCCAAACCTAGGAGAAGACCAGGCAGAAGAGATTTCAGATGAATTAATGG
AGTTTTCCCTGAAAGATCAAGAAGCAAAGGTGAGCAGAAGTGGCCTATATCGCTCCCCGT
CGATGCCAGAGAACTTGAACAGGCCAAGACTGAAGCAGGTGGAAAAATTCAAGGACAACA
CAATACCAGATAAAGTTAAAAAAAAGTATTTTTCTGGCCAAGGAAAGCTCAGGAAGGGCT
TATGTTTAAAGAAGACAGTCTCTCTGTGTGACATTACTATCACTCAGATGCTGGAGGAAG
ATTCTAACCAGGGGCACCTGATTGGTGATTTTTCCAAGGTATGTGCGCTGCCAACCGTGT
CAGGGAAACACCAAGATCTGAAGTATGTCAACCCAGAAACAGTGGCTGCCTTACTGTCGG
GGAAGTTCCAGGGTCTGATTGAGAAGTTTTATGTCATTGATTGTCGCTATCCATATGAGT
ATCTGGGAGGACACATCCAGGGAGCCTTAAACTTATATAGTCAGGAAGAACTGTTTAACT
TCTTTCTGAAGAAGCCCATCGTCCCTTTGGACACCCAGAAGAGAATAATCATCGTGTTCC
ACTGTGAATTCTCCTCAGAGAGGGGCCCCCGAATGTGCCGCTGTCTGCGTGAAGAGGACA
GGTCTCTGAACCAGTATCCTGCATTGTACTACCCAGAGCTATATATCCTTAAAGGCGGCT
ACAGAGACTTCTTTCCAGAATATATGGAACTGTGTGAACCACAGAGCTACTGCCCTATGC
ATCATCAGGACCACAAGACTGAGTTGCTGAGGTGTCGAAGCCAGAGCAAAGTGCAGGAAG
GGGAGCGGCAGCTGCGGGAGCAGATTGCCCTTCTGGTGAAGGACATGAGCCCATGATAAC
ATTCCAGCCACTGGCTGCTAACAAGTCACCAAAAGACACTGCAGAAACCCTGAGCAGAAA
GAGGCCTTCTGGATGGCCAAACCCAAGATTATTAAAAGATGTCTCTGCAAACCAACAGGC
TACCAACTTGTATCCAGGCCTGGGAATGGATTAGGTTTCAGCAGAGCTGAAAGCTGGTGG
CAGAGTCCTGGAGCTGGCTCTATAAGGCAGCCTTGAGTTGCATAGAGATTTGTATTGGTT
CAGGGAACTCTGGCATTCCTTTTCCCAACTCCTCATGTCTTCTCACAAGCCAGCCAACTC
TTTCTCTCTGGGCTTCGGGCTATGCAAGAGCGTTGTCTACCTTCTTTCTTTGTATTTTCC
TTCTTTGTTTCCCCCTCTTTCTTTTTTAAAAATGGAAAAATAAACACTACAGAATGAGAG
GTGAAAAAAAAAAAAAAAAAAAAA

Protein Sequence

>995 : length: 551
MEGAAPCRVSLKVSLGQRCWERAWRFDLGMGVVSSLTSHPLQNIAESGRPQLEAHLETRG
GGHVGRRFCFSPGENSKTMSTELFSSTREEGSSGSGPSFRSNQRKMLNLLLERDTSFTVC
PDVPRTPVGKFLGDSANLSILSGGTPKRCLDLSNLSSGEITATQLTTSADLDETGHLDSS
GLQEVHLAGMNHDQHLMKCSPAQLLCSTPNGLDRGHRKRDAMCSSSANKENDNGNLVDSE
MKYLGSPITTVPKLDKNPNLGEDQAEEISDELMEFSLKDQEAKVSRSGLYRSPSMPENLN
RPRLKQVEKFKDNTIPDKVKKKYFSGQGKLRKGLCLKKTVSLCDITITQMLEEDSNQGHL
IGDFSKVCALPTVSGKHQDLKYVNPETVAALLSGKFQGLIEKFYVIDCRYPYEYLGGHIQ
GALNLYSQEELFNFFLKKPIVPLDTQKRIIIVFHCEFSSERGPRMCRCLREEDRSLNQYP
ALYYPELYILKGGYRDFFPEYMELCEPQSYCPMHHQDHKTELLRCRSQSKVQEGERQLRE
QIALLVKDMSP