ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

9935

Name

MAFB

Synonym

KRML|MCTO;v-maf avian musculoaponeurotic fibrosarcoma oncogene homolog B;MAFB;v-maf avian musculoaponeurotic fibrosarcoma oncogene homolog B

Definition

Kreisler maf-related leucine zipper homolog|MAFB/Kreisler basic region/leucine zipper transcription factor|transcription factor MafB

Position

20q12

Gene Type

protein-coding

External Links

Links to cell senescence gene database

9935

Links to epithelial mesenchymal transition gene database

9935

Links to ovarian cancer gene database

9935

Links to endometrial cancer gene database

9935

Links to iHOP

9935

Sequence Information

Nucleotide Sequence

>9935 : length: 3395
CAGCACAGCTGCACCGCCGAGCTGCGAGCGGCTGCGAGCGAGAGAGCGTAAGAGCAAGAG
AGCTAGAGAGCGAGCAACGGGCACTCGCCCCACGCCTCCCCTCAGCCCCACCGCGCGCTC
CGCTTGCCTCTCCACCCCGCCCGACTCTACCCGGCCCGGTCCCTGCGCGGGCACAGCCCA
GAGCTCTGGGGCGGTGCAGGCAGCCTCGGGACTCTCCGGCGCGCCGCCGCGTCCCCAGAC
AAAGGCTTGGCCGGCGGCCCCGGCCCGCTGCGCCCTCGCTCCCCGCCTCCCCAGCTCTTC
TCCGCTCTTCCCCCCCGCGCTTGGCTCGGCGCGCTCCGGCCGGCCGCAAAGTTTCCCGGG
CGGCAGCGGCGGCTGCGCCTCGCTTCAGCGATGGCCGCGGAGCTGAGCATGGGGCCAGAG
CTGCCCACCAGCCCGCTGGCCATGGAGTATGTCAACGACTTCGACCTGCTCAAGTTCGAC
GTGAAGAAGGAGCCACTGGGGCGCGCGGAGCGTCCGGGCAGGCCCTGCACACGCCTGCAG
CCAGCCGGCTCGGTGTCCTCCACACCGCTCAGCACTCCGTGTAGCTCCGTGCCCTCGTCG
CCCAGCTTCAGCCCGACCGAACAGAAGACACACCTCGAGGATCTGTACTGGATGGCGAGC
AACTACCAGCAGATGAACCCCGAGGCGCTCAACCTGACGCCCGAGGACGCGGTGGAAGCG
CTCATCGGCTCGCACCCAGTGCCACAGCCGCTGCAAAGCTTCGACAGCTTTCGCGGCGCT
CACCACCACCACCATCACCACCACCCTCACCCGCACCACGCGTACCCGGGCGCCGGCGTG
GCCCACGACGAGCTGGGCCCGCACGCTCACCCGCACCATCACCATCATCACCAAGCGTCG
CCGCCGCCGTCCAGCGCCGCTAGCCCGGCGCAACAGCTGCCCACTAGCCACCCCGGGCCC
GGGCCGCACGCGACGGCCTCGGCGACGGCGGCGGGCGGCAACGGCAGCGTGGAGGACCGC
TTCTCCGACGACCAGCTCGTGTCCATGTCCGTGCGCGAGCTGAACCGCCACCTGCGGGGC
TTCACCAAGGACGAGGTGATCCGCCTGAAGCAGAAGCGGCGGACCCTGAAGAACCGGGGC
TACGCCCAGTCTTGCAGGTATAAACGCGTCCAGCAGAAGCACCACCTGGAGAATGAGAAG
ACGCAGCTCATTCAGCAGGTGGAGCAGCTTAAGCAGGAGGTGTCCCGGCTGGCCCGCGAG
AGAGACGCCTACAAGGTCAAGTGCGAGAAACTCGCCAACTCCGGCTTCAGGGAGGCGGGC
TCCACCAGCGACAGCCCCTCCTCTCCCGAGTTCTTTCTGTGAGTCGTGGCCGGTCCTGGC
CCCCGCCCTTGCCCCGGCCCGGACTCCCTGTCCCACGTCCCTAGTCCCAGACTACCCCGG
ACCCTGTCCCTGCCGCGGCCCCAGCCTTGACCTGTTTGACTTGAGCGAGAGGGAGGAAGG
GCGCGCGGGCCGCGGGCGACGGGCGGGTGCGCGGGCGGGCAGGGGACCTTGGCTAAGGCG
AGAGTAGCGCACGCCAGCGCCGCCTCCTAGACTCGAGCAGAGCCGGAGAGAGAGACGAGA
GGGTGGGAGGTCCCGGAGTAACTTCTCTCCAGGCTGAAGGGCGGCGAGGCATAGTCCCGA
GAAGTCACCAAGGCCATCTGGAGACTCCTGGCTTTCTGAACTTTGCGCGTTAAGCCGGGA
CAGCTGCTTTGCTGCCCGGAGAGTAGTCCGCGCCAGGAAGAGAGCAACGAGGAAAGGAGA
GGGACTCTGGCGTCCCGGCAGGCGAGAGGCGAGGCTGAGCGAAAGAAGGAAGGACAGACG
GACCTGTCTGTCAGAGTTCGGAGAACACTGGCTCTCAGCCCTGAGACACAGGCCTCAGTT
AGGACGCTCGGCGCCCAAATCTCATCAGTTTTATTGCCTGCTCGATTATATAGAAAAATA
CAAAAAATCTGCATTAAAAATATTAATCCTGCATGCTGGACATGTATGGTAATAATTTCT
ATTTTGTACCATTTTCTTGTTTAACTTTAGCATGTTGTTGATCATGGATCATACTCCCCT
TGTTTCTTTGGGTGAGAAGGGATCGCAGTTTGGAAACTCCGGCGGCTGCGTGCGGGGTTT
CAGTCCCAGCTGTAGGCTTGTAAATACCCGCCCCGCCAAACCGCATAGAGAACGTGGCAG
CAAGCTGAGGGTCTTTGTTTGGGTTTATTATTACGGTATTTTTGTTTGTAAGTTAAAAAG
AAAAAAAAAAAGAAAAAGTTCCGGGCATTTTGCATCAGAAAACAACTTTGTCTTGGGGCA
CACTTGGAAGTTGCATGTTTTCTTTCCTTCCCTTATCCCCATTCGGTCCTCTTTTTCCTC
TCTCGCTTTAGTTTTCAACCTTGTTGGTGCTGAGAGAGAGAACCGAGAGGTCCCAGTACA
AGGGCAGGGCAGGGCAGGGAAGCTGCCAAGCTCCGCACCCCAGAGGAGTGTTCTGGACTA
CAGCCTTGTCTTATGGTCAAATTGATACCCTTAATAAGAAAGGAAAGGAAAGGAAAACAG
ATCCTCCCCTCTGCTTTTTATTGTAACCAGAATCACCCTGAGGTCCCTTCTGAACCCTCT
GGGCCTGCGCTAATTGTAGGAGCCACAGCGCTCCTAGGGTGAGAGGCTTAGCCATCCCTG
ACCCTGGCAGTGCACTGGTAAGCAGACACTGCACTGAACCAACTGCTATGCTCAGAATGT
ACCAGAAACCCAAACATTGGCAAGTAATTTTGCAACTTTCAAGTGCGTTCTTTAGACCAA
TGCATTGCGTTTCTTTCCCTGCTTTTGAGATAGTAGGAAGAGTTCTTGGTGGTGTCCCCC
CCCTTCAATTCTTCAGTTGTATAGTAGTTATAGGGAAGATATGGGTGTTTTTCTTTATTA
TTACTTTTTTTTTTCTGCAGGTCAGTAAAAGGATTTAAGTTGCACTGACAAAAATACCAA
AATAAAAGTGTATTTTTAAGTTCCCATTTGAAATTGCTGGCGCTGCTGGCCGGATGCATT
TTTGAGTTTGTATTAGTTGATAAATTAACAGTAATAACAAGATTGTATGAACCGCATGGT
GCTTGCAGTTTTAAATATTGTGGATATTTGTCCTGCATCAGAAACGAGCTTTGGTTTTTA
CAGATTCAACTGTGTTGAAATCAAACCTGCCGCAACAGAAATTGTTTTTATTTCATGTAA
AATAAGGGATCAATTTCAAACCCTGCTTATGATATGAAAATATTAAAACCTAGTCTATTG
TAGTTTTATTCAGACTGGTTTCTGTTTTTTGGTTATTAAAATGGTTTCCTATTTTGCTTA
TTAAAACCATGGAAATGGTGTTTATTTAGAGGAAA

Protein Sequence

>9935 : length: 323
MAAELSMGPELPTSPLAMEYVNDFDLLKFDVKKEPLGRAERPGRPCTRLQPAGSVSSTPL
STPCSSVPSSPSFSPTEQKTHLEDLYWMASNYQQMNPEALNLTPEDAVEALIGSHPVPQP
LQSFDSFRGAHHHHHHHHPHPHHAYPGAGVAHDELGPHAHPHHHHHHQASPPPSSAASPA
QQLPTSHPGPGPHATASATAAGGNGSVEDRFSDDQLVSMSVRELNRHLRGFTKDEVIRLK
QKRRTLKNRGYAQSCRYKRVQQKHHLENEKTQLIQQVEQLKQEVSRLARERDAYKVKCEK
LANSGFREAGSTSDSPSSPEFFL