ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

993

Name

CDC25A

Synonym

CDC25A2;cell division cycle 25A;CDC25A;cell division cycle 25A

Definition

CDC25 isoform A1-CAG|CDC25A2-CAG isoform|M-phase inducer phosphatase 1|dual specificity phosphatase CDC25A

Position

3p21

Gene Type

protein-coding

Pathways and Diseases

Pathway

E2F transcription factor network;PID Curated;200027

Pathway

Activation of ATR in response to replication stress;PID Reactome;500319

Pathway

cyclins and cell cycle regulation;PID BioCarta;100207

Pathway

p53-Independent DNA Damage Response;PID Reactome;500994

Pathway

Progesterone-mediated oocyte maturation;KEGG PATHWAY;hsa04914

Pathway

Cell Cycle Checkpoints;Reactome;REACT:1538

Pathway

Ubiquitin Mediated Degradation of Phosphorylated Cdc25A;PID Reactome;500938

Pathway

Cyclin A:Cdk2-associated events at S phase entry;PID Reactome;500375

Pathway

Cell Cycle, Mitotic;Reactome;REACT:152

Pathway

cell cycle: g1/s check point;PID BioCarta;100160

Pathway

Cell cycle;KEGG PATHWAY;hsa04110

Pathway

Validated targets of C-MYC transcriptional activation;PID Curated;200045

Pathway

Cyclin E associated events during G1/S transition;PID Reactome;500877

Disease

altered cell-cycle;GAD

External Links

Links to cell senescence gene database

993

Links to epithelial mesenchymal transition gene database

993

Links to ovarian cancer gene database

993

Links to endometrial cancer gene database

993

Links to iHOP

993

Sequence Information

Nucleotide Sequence

>993 : length: 3899
CTGCTGGGAGTTTTCATTGACCTCTGCTCCCCCTCTCATTTTGATCCCCGCTCTTCTGCT
CTGGGCTCCGCCCCCTTCTGAGAGCCGATGACCTGGCAGAGTCCCGCGAGCCGCTTTCTT
CTTCCCCTCTCATTGGCCCAGCCTAGCTGCCATTCGGTTGAGAGGAGGAGAAGTTGCTTA
CTGATTGGTGGATTCCGTTTGGCGCCAACTAGGAAAGGGGGGCGGGGCAGCAGCTGGCCC
CACTGAGCCGCTATTACCGCGAAAGGCCGGCCTGGCTGCGACAGCCTGGGTTGCCGGCGC
CCGCCCGCCCGCTGGCCTCGCGGTGTGAGAGGGAAGCACCCGTGCCTGTGGCTGGTGGCT
GGCGCCTGGAGGGTCCGCACACCCGCCCGGCCGCGCCGCTTGCCCGCGGCAGCCGCGTCC
CTGAACCGCGGAGTCGTGTTTGTGTTTGACCCGCGGGCGCCGGTGGCGCGCGGCCGAGGC
CGGTGTCGGCGGGGCGGGGCGGTCGCGGCGGAGGCAGAGGAAGAGGGAGCGGGAGCTCTG
CGAGGCCGGGCGCCGCCATGGAACTGGGCCCGGAGCCCCCGCACCGCCGCCGCCTGCTCT
TCGCCTGCAGCCCCCCTCCCGCGTCGCAGCCCGTCGTGAAGGCGCTATTTGGCGCTTCAG
CCGCCGGGGGACTGTCGCCTGTCACCAACCTGACCGTCACTATGGACCAGCTGCAGGGTC
TGGGCAGTGATTATGAGCAACCACTGGAGGTGAAGAACAACAGTAATCTGCAGAGAATGG
GCTCCTCCGAGTCAACAGATTCAGGTTTCTGTCTAGATTCTCCTGGGCCATTGGACAGTA
AAGAAAACCTTGAAAATCCTATGAGAAGAATACATTCCCTACCTCAGAAGCTGTTGGGAT
GTAGTCCAGCTCTGAAGAGGAGCCATTCTGATTCTCTTGACCATGACATCTTTCAGCTCA
TCGACCCAGATGAGAACAAGGAAAATGAAGCCTTTGAGTTTAAGAAGCCAGTAAGACCTG
TATCTCGTGGCTGCCTGCACTCTCATGGACTCCAGGAGGGTAAAGATCTCTTCACACAGA
GGCAGAACTCTGCCCCAGCTCGGATGCTTTCCTCAAATGAAAGAGATAGCAGTGAACCAG
GGAATTTCATTCCTCTTTTTACACCCCAGTCACCTGTGACAGCCACTTTGTCTGATGAGG
ATGATGGCTTCGTGGACCTTCTCGATGGAGAGAATCTGAAGAATGAGGAGGAGACCCCCT
CGTGCATGGCAAGCCTCTGGACAGCTCCTCTCGTCATGAGAACTACAAACCTTGACAACC
GATGCAAGCTGTTTGACTCCCCTTCCCTGTGTAGCTCCAGCACTCGGTCAGTGTTGAAGA
GACCAGAACGATCTCAAGAGGAGTCTCCACCTGGAAGTACAAAGAGGAGGAAGAGCATGT
CTGGGGCCAGCCCCAAAGAGTCAACTAATCCAGAGAAGGCCCATGAGACTCTTCATCAGT
CTTTATCCCTGGCATCTTCCCCCAAAGGAACCATTGAGAACATTTTGGACAATGACCCAA
GGGACCTTATAGGAGACTTCTCCAAGGGTTATCTCTTTCATACAGTTGCTGGGAAACATC
AGGATTTAAAATACATCTCTCCAGAAATTATGGCATCTGTTTTGAATGGCAAGTTTGCCA
ACCTCATTAAAGAGTTTGTTATCATCGACTGTCGATACCCATATGAATACGAGGGAGGCC
ACATCAAGGGTGCAGTGAACTTGCACATGGAAGAAGAGGTTGAAGACTTCTTATTGAAGA
AGCCCATTGTACCTACTGATGGCAAGCGTGTCATTGTTGTGTTTCACTGCGAGTTTTCTT
CTGAGAGAGGTCCCCGCATGTGCCGGTATGTGAGAGAGAGAGATCGCCTGGGTAATGAAT
ACCCCAAACTCCACTACCCTGAGCTGTATGTCCTGAAGGGGGGATACAAGGAGTTCTTTA
TGAAATGCCAGTCTTACTGTGAGCCCCCTAGCTACCGGCCCATGCACCACGAGGACTTTA
AAGAAGACCTGAAGAAGTTCCGCACCAAGAGCCGGACCTGGGCAGGGGAGAAGAGCAAGA
GGGAGATGTACAGTCGTCTGAAGAAGCTCTGAGGGCGGCAGGACCAGCCAGCAGCAGCCC
AAGCTTCCCTCCATCCCCCTTTACCCTCTTTGCTGCAGAGAAACTTAAGCAAAGGGGACA
GCTGTGTGACATTTGGAGAGGGGGCCTGGGACTTCCATGCCTTAAACCTACCTCCCACAC
TCCCAAGGTTGGAGCCCAGGGCATCTTGCTGGCTACGCCTCTTCTGTCCCTGTTAGACGT
CCTCCGTCCATATCAGAACTGTGCCACAATGCAGTTCTGAGCACCGTGTCAAGCTGCTCT
GAGCCACAGTGGGATGAACCAGCCGGGGCCTTATCGGGCTCCAGCCATCTCATGAGGGGA
GAGGAGACGGAGGGGAGTAGAGAAGTTACACAGAAATGCTGCTGGCCAAATAGCAAAGAC
AACCTGGGAAGGAAAGGTCTTTGTGGGATAATCCATATGTTTAATTTATTCAACTTCATC
AATCACTTTATTTTATTTTTTTTTCTAACTCCTGGAGACTTATTTTACTGCTTCATTAGG
TTGAAATACTGCCATTCTAGGTAGGGTTTTATTATCCCAGGGACTACCTCGGCTTTTAAT
TTAAAAAAAAAAAAGAAGTGGGTAAGAAAATGCAAACCTGTTATAAGTTATCGGACAGAA
AGCTAGGTGCTCTGTCACCCCCAGGAGGCGCTGTGGTACTGGGGCTGCTGCTATTTAAGC
CAAGAACTGAGGTCCTGGTGAGAGCGTTGGACCCAGGCTTGGCTGCCTGACATAAGCTAA
ATCTCCCAGACCCACCACTGGCTACCGATATCTATTTGGTGGGAGGTGTGGCCCTGTTCT
TCCTCACCCCAGTTCCATGACATTGGCTGGTATAGGAGCCACAGTCAGGAAAGCACTTGA
GGCAGCATCTGTTGGGCCACCCCCGGCTCAGTGCTGGAATGTTGCAGTGTAGGTTTCCCA
GGGAAGGGGGGTGGGGGTAGGTGGGCTCCACAGGATGGGGGAGGAGCATGTCCACTGAGT
ATCTTCCTTATGTTGCTGTGATATTGATAGCTTTTATTTTCTAATTTTTAAAAAATGGTC
ATATTATGAGTCAAAGAGTATCAAATCAGTGTTGGATGGACCACCCAAGGGTGAGGAGAG
GGGCTGGAAGCCCTGGGCATTAGGAGAAGGGAGTGGGTGCTGGCATGGACATGACTGGAT
AGAATTTTCTCAGGAGGGAGCTTGGTGGATTTTGAAGGTAAAACTTTCTGGGTTTATCAT
GTTTTAATTTTAGAGACAGGGAGTGATGAATCATCACCGGTTGTCCCCTTATCTAACTCC
ATAAAAGTGGGAATTTCAAAAGAACACCTCATCCAAGGAGCTGGGGCAGACTTCATTGAT
TCTAGAGAGACCTGTTTCAGTGCCTACTCATCCCTGCCCTCTGGTGCCAGCCTCCTTACC
ATCACGGCTTCACTGAGGTGTAGGTGGGTTTTTCTTAAACAGGAGACAGTCTCTCCCCTC
TTACCTCAACTTCTTGGGGTGGGAATCAGTGATACTGGAGATGGCTAGTTGCTGTGTTAC
GGGTTTGAGTTACATTTGGCTATAAAACAATCTTGTTGGGAAAAATGTGGGGGAGAGGAC
TTCTTCCTACACGCGCATTGAGACAGATTCCAACTGGTTAATGATATTGTTTGTAAGAAA
GAGATTCTGTTGGTTGACTGCCTAAAGAGAAAGGTGGGATGGCCTTCAGATTATACCAGC
TTAGCTAGCATTACTAACCAACTGTTGGAAGCTCTGAAAATAAAAGATCTTGAACCCAT

Protein Sequence

>993 : length: 524
MELGPEPPHRRRLLFACSPPPASQPVVKALFGASAAGGLSPVTNLTVTMDQLQGLGSDYE
QPLEVKNNSNLQRMGSSESTDSGFCLDSPGPLDSKENLENPMRRIHSLPQKLLGCSPALK
RSHSDSLDHDIFQLIDPDENKENEAFEFKKPVRPVSRGCLHSHGLQEGKDLFTQRQNSAP
ARMLSSNERDSSEPGNFIPLFTPQSPVTATLSDEDDGFVDLLDGENLKNEEETPSCMASL
WTAPLVMRTTNLDNRCKLFDSPSLCSSSTRSVLKRPERSQEESPPGSTKRRKSMSGASPK
ESTNPEKAHETLHQSLSLASSPKGTIENILDNDPRDLIGDFSKGYLFHTVAGKHQDLKYI
SPEIMASVLNGKFANLIKEFVIIDCRYPYEYEGGHIKGAVNLHMEEEVEDFLLKKPIVPT
DGKRVIVVFHCEFSSERGPRMCRYVRERDRLGNEYPKLHYPELYVLKGGYKEFFMKCQSY
CEPPSYRPMHHEDFKEDLKKFRTKSRTWAGEKSKREMYSRLKKL