ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

990

Name

CDC6

Synonym

CDC18L|HsCDC18|HsCDC6;cell division cycle 6;CDC6;cell division cycle 6

Definition

CDC6 cell division cycle 6 homolog|CDC6-related protein|cdc18-related protein|cell division control protein 6 homolog|cell division cycle 6 homolog|p62(cdc6)

Position

17q21.3

Gene Type

protein-coding

Pathways and Diseases

Pathway

E2F transcription factor network;PID Curated;200027

Pathway

CDC6 association with the ORC:origin complex;PID Reactome;500388

Pathway

cdk regulation of dna replication;PID BioCarta;100110

Pathway

Cell Cycle Checkpoints;Reactome;REACT:1538

Pathway

Cell Cycle, Mitotic;Reactome;REACT:152

Pathway

Orc1 removal from chromatin;PID Reactome;500892

Pathway

Cell cycle;KEGG PATHWAY;hsa04110

Pathway

Association of licensing factors with the pre-replicative complex;PID Reactome;500987

Pathway

CDK-mediated phosphorylation and removal of Cdc6;PID Reactome;500925

Pathway

DNA Replication;Reactome;REACT:383

Disease

CANCER;GAD

Disease

Pulmonary Disease, Chronic Obstructive;GAD

Disease

Liver Neoplasms;GAD

Disease

CARDIOVASCULAR;GAD

Disease

Carcinoma, Hepatocellular;GAD

External Links

Links to cell senescence gene database

990

Links to epithelial mesenchymal transition gene database

990

Links to ovarian cancer gene database

990

Links to endometrial cancer gene database

990

Links to iHOP

990

Sequence Information

Nucleotide Sequence

>990 : length: 3136
GTAGATTCCCTCCCCCGTTCAGTGGTCGTGGCCTCACAGCGACTCTAAGACTTGGGGCTC
TCTCATTGGCTGTAACTCTTCCACTGGATTGGTAGCAAAAAAAGAGGCGGTGCCCAAGGC
GAAAGGCTCTGTGACTACAGCCAATCAGAATCGAGGCCGGGCTTTGGCGGGAGGTGGGAA
CGCTGTGGCCATTCGGATTTGGCGCGAGCGCGGCTGGAGTTTGCTGCTGCCGCTGTGCAG
TTTGTTCAGGGGCTTGTGGTGGTGAGTCCGAGAGGCTGCGTGTGAGAGACGTGAGAAGGA
TCCTGCACTGAGGAGGTGGAAAGAAGAGGATTGCTCGAGGAGGCCTGGGGTCTGTGAGGC
AGCGGAGCTGGGTGAAGGCTGCGGGTTCCGGCGAGGCCTGAGCTGTGCTGTCGTCATGCC
TCAAACCCGATCCCAGGCACAGGCTACAATCAGTTTTCCAAAAAGGAAGCTGTCTCGGGC
ATTGAACAAAGCTAAAAACTCCAGTGATGCCAAACTAGAACCAACAAATGTCCAAACCGT
AACCTGTTCTCCTCGTGTAAAAGCCCTGCCTCTCAGCCCCAGGAAACGTCTGGGCGATGA
CAACCTATGCAACACTCCCCATTTACCTCCTTGTTCTCCACCAAAGCAAGGCAAGAAAGA
GAATGGTCCCCCTCACTCACATACACTTAAGGGACGAAGATTGGTATTTGACAATCAGCT
GACAATTAAGTCTCCTAGCAAAAGAGAACTAGCCAAAGTTCACCAAAACAAAATACTTTC
TTCAGTTAGAAAAAGTCAAGAGATCACAACAAATTCTGAGCAGAGATGTCCACTGAAGAA
AGAATCTGCATGTGTGAGACTATTCAAGCAAGAAGGCACTTGCTACCAGCAAGCAAAGCT
GGTCCTGAACACAGCTGTCCCAGATCGGCTGCCTGCCAGGGAAAGGGAGATGGATGTCAT
CAGGAATTTCTTGAGGGAACACATCTGTGGGAAAAAAGCTGGAAGCCTTTACCTTTCTGG
TGCTCCTGGAACTGGAAAAACTGCCTGCTTAAGCCGGATTCTGCAAGACCTCAAGAAGGA
ACTGAAAGGCTTTAAAACTATCATGCTGAATTGCATGTCCTTGAGGACTGCCCAGGCTGT
ATTCCCAGCTATTGCTCAGGAGATTTGTCAGGAAGAGGTATCCAGGCCAGCTGGGAAGGA
CATGATGAGGAAATTGGAAAAACATATGACTGCAGAGAAGGGCCCCATGATTGTGTTGGT
ATTGGACGAGATGGATCAACTGGACAGCAAAGGCCAGGATGTATTGTACACGCTATTTGA
ATGGCCATGGCTAAGCAATTCTCACTTGGTGCTGATTGGTATTGCTAATACCCTGGATCT
CACAGATAGAATTCTACCTAGGCTTCAAGCTAGAGAAAAATGTAAGCCACAGCTGTTGAA
CTTCCCACCTTATACCAGAAATCAGATAGTCACTATTTTGCAAGATCGACTTAATCAGGT
ATCTAGAGATCAGGTTCTGGACAATGCTGCAGTTCAATTCTGTGCCCGCAAAGTCTCTGC
TGTTTCAGGAGATGTTCGCAAAGCACTGGATGTTTGCAGAAAGGAGGACTTGTTTCTCAG
TGGGGAGCTCTGGATTTCCACCGTGTTAATGTCTGAAACATTATCAGTCCATTACCTACA
GAGGGAGAAACAAATGAGATGTTGCTGGCACTCCCTGTGGAGAGCTATTGAAATTGTAGA
GTCAGATGTCAAAAGCCAGACTATTCTCAAACCACTGTCTGAATGTAAATCACCTTCTGA
GCCTCTGATTCCCAAGAGGGTTGGTCTTATTCACATATCCCAAGTCATCTCAGAAGTTGA
TGGTAACAGGATGACCTTGAGCCAAGAAGGAGCACAAGATTCCTTCCCTCTTCAGCAGAA
GATCTTGGTTTGCTCTTTGATGCTCTTGATCAGGCAGTTGAAAATCAAAGAGGTCACTCT
GGGGAAGTTATATGAAGCCTACAGTAAAGTCTGTCGCAAACAGCAGGTGGCGGCTGTGGA
CCAGTCAGAGTGTTTGTCACTTTCAGGGCTCTTGGAAGCCAGGGGCATTTTAGGATTAAA
GAGAAACAAGGAAACCCGTTTGACAAAGGTGTTTTTCAAGATTGAAGAGAAAGAAATAGA
ACATGCTCTGAAAGATAAAGCTTTAATTGGAAATATCTTAGCTACTGGATTGCCTTAAAT
TCTTCTCTTACACCCCACCCGAAAGTATTCAGCTGGCATTTAGAGAGCTACAGTCTTCAT
TTTAGTGCTTTACACATTCGGGCCTGAAAACAAATATGACCTTTTTTACTTGAAGCCAAT
GAATTTTAATCTATAGATTCTTTAATATTAGCACAGAATAATATCTTTGGGTCTTACTAT
TTTTACCCATAAAAGTGACCAGGTAGACCCTTTTTAATTACATTCACTACTTCTACCACT
TGTGTATCTCTAGCCAATGTGCTTGCAAGTGTACAGATCTGTGTAGAGGAATGTGTGTAT
ATTTACCTCTTCGTTTGCTCAAACATGAGTGGGTATTTTTTTGTTTGTTTTTTTTGTTGT
TGTTGTTTTTGAGGCGCGTCTCACCCTGTTGCCCAGGCTGGAGTGCAATGGCGCGTTCTC
TGCTCACTACAGCACCCGCTTCCCAGGTTGAAGTGATTCTCTTGCCTCAGCCTCCCGAGT
AGCTGGGATTACAGGTGCCCACCACCGCGCCCAGCTAATTTTTTAATTTTTAGTAGAGAC
AGGGTTTTACCATGTTGGCCAGGCTGGTCTTGAACTCCTGACCCTCAAGTGATCTGCCCA
CCTTGGCCTCCCTAAGTGCTGGGATTATAGGCGTGAGCCACCATGCTCAGCCATTAAGGT
ATTTTGTTAAGAACTTTAAGTTTAGGGTAAGAAGAATGAAAATGATCCAGAAAAATGCAA
GCAAGTCCACATGGAGATTTGGAGGACACTGGTTAAAGAATTTATTTCTTTGTATAGTAT
ACTATGTTCATGGTGCAGATACTACAACATTGTGGCATTTTAGACTCGTTGAGTTTCTTG
GGCACTCCCAAGGGCGTTGGGGTCATAAGGAGACTATAACTCTACAGATTGTGAATATAT
TTATTTTCAAGTTGCA

Protein Sequence

>990 : length: 600
MPQTRSQAQATISFPKRKLSRALNKAKNSSDAKLEPTNVQTVTCSPRVKALPLSPRKRLG
DDNLCNTPHLPPCSPPKQGKKENGPPHSHTLKGRRLVFDNQLTIKSPSKRELAKVHQNKI
LSSVRKSQEITTNSEQRCPLKKESACVRLFKQEGTCYQQAKLVLNTAVPDRLPAREREMD
VIRNFLREHICGKKAGSLYLSGAPGTGKTACLSRILQDLKKELKGFKTIMLNCMSLRTAQ
AVFPAIAQEICQEEVSRPAGKDMMRKLEKHMTAEKGPMIVLVLDEMDQLDSKGQDVLYTL
FEWPWLSNSHLVLIGIANTLDLTDRILPRLQAREKCKPQLLNFPPYTRNQIVTILQDRLN
QVSRDQVLDNAAVQFCARKVSAVSGDVRKALDVCRKEDLFLSGELWISTVLMSETLSVHY
LQREKQMRCCWHSLWRAIEIVESDVKSQTILKPLSECKSPSEPLIPKRVGLIHISQVISE
VDGNRMTLSQEGAQDSFPLQQKILVCSLMLLIRQLKIKEVTLGKLYEAYSKVCRKQQVAA
VDQSECLSLSGLLEARGILGLKRNKETRLTKVFFKIEEKEIEHALKDKALIGNILATGLP