ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

988

Name

CDC5L

Synonym

CDC5|CDC5-LIKE|CEF1|PCDC5RP|dJ319D22.1;cell division cycle 5-like;CDC5L;cell division cycle 5-like

Definition

CDC5 cell division cycle 5-like|Cdc5-related protein|cell division cycle 5-like protein|dJ319D22.1 (CDC5-like protein)|pombe cdc5-related protein

Position

6p21

Gene Type

protein-coding

Pathways and Diseases

Pathway

Spliceosome;KEGG PATHWAY;hsa03040

External Links

Links to cell senescence gene database

988

Links to epithelial mesenchymal transition gene database

988

Links to ovarian cancer gene database

988

Links to endometrial cancer gene database

988

Links to iHOP

988

Sequence Information

Nucleotide Sequence

>988 : length: 6432
GAGAGCCGTAGTTTCTTCCATTCTGTTTTGGACATGCGCGGGGCGTAAGGCGCTTTGGCC
AGAGTGGTTTGATGGTTTTGTGTTAGTCTTCCTGCAGCTGAGCTTCCACAAGACACTTTT
TCCCTTTCAGCCACCCAATATCTCGCGAGACTTGCTATTCTGCGCCCCCTCCCACCTTGC
GCTTGCGCAGATCTTCAAAGCAGAAGGTCGCGCTTGGAGGAAGTGGCGGCTTTGAGTCCG
GTGGCCCAATCGCTGTTACTACTTCTCTGAAGCTCCTCTCGGCTGCTTGCCGAGACACCC
TGCCGCCAAGATGCCTCGAATTATGATCAAGGGGGGCGTATGGAGGAATACCGAGGATGA
AATTCTGAAAGCAGCGGTAATGAAATATGGGAAAAATCAGTGGTCTAGGATTGCCTCATT
GCTGCATAGAAAATCAGCAAAGCAGTGCAAAGCCAGATGGTATGAATGGCTGGATCCAAG
CATTAAGAAGACAGAATGGTCCAGAGAAGAAGAGGAAAAACTCTTGCACTTGGCCAAGTT
GATGCCAACTCAGTGGAGGACCATTGCTCCAATCATTGGAAGAACAGCGGCCCAGTGCTT
AGAACACTATGAATTTCTTCTGGATAAAGCTGCCCAAAGAGACAATGAAGAGGAAACAAC
AGATGATCCACGAAAACTTAAACCTGGAGAAATAGATCCAAATCCAGAAACAAAACCAGC
GCGGCCTGATCCAATTGATATGGATGAGGATGAACTTGAGATGCTTTCTGAAGCCAGAGC
CCGCTTGGCTAATACTCAGGGAAAGAAGGCCAAGAGGAAAGCAAGAGAGAAACAATTGGA
AGAAGCAAGACGTCTTGCTGCCCTCCAAAAAAGAAGAGAACTTCGAGCAGCTGGCATAGA
AATTCAGAAGAAAAGAAAAAGGAAGAGAGGAGTTGATTATAATGCCGAAATCCCATTTGA
AAAAAAGCCTGCCCTTGGTTTTTATGATACTTCTGAGGAAAACTACCAAGCTCTTGACGC
AGATTTCAGGAAATTAAGACAACAGGATCTTGATGGGGAGCTAAGATCTGAAAAAGAAGG
AAGAGATAGAAAAAAAGACAAACAGCATTTGAAAAGGAAAAAAGAATCTGATTTACCATC
AGCTATTCTTCAAACTAGTGGTGTTTCTGAATTTACTAAAAAGAGAAGCAAACTAGTACT
TCCTGCCCCTCAGATTTCAGATGCAGAACTCCAGGAAGTTGTAAAAGTAGGCCAAGCGAG
TGAAATTGCACGTCAAACTGCCGAGGAATCTGGCATAACAAATTCTGCTTCCAGTACACT
TTTGTCTGAGTACAATGTCACCAACAACAGCGTTGCTCTTAGAACACCACGAACACCAGC
TTCCCAGGACAGAATTCTGCAGGAAGCCCAGAACCTCATGGCCCTCACCAATGTGGACAC
CCCATTGAAAGGTGGACTTAATACCCCATTGCATGAGAGTGACTTCTCAGGTGTAACTCC
ACAGCGACAAGTTGTACAGACTCCAAACACAGTTCTCTCTACTCCATTCAGGACTCCTTC
TAATGGAGCTGAAGGGCTGACTCCCCGGAGTGGAACAACTCCCAAACCAGTTATTAACTC
TACTCCGGGTAGAACTCCTCTTCGAGACAAGTTAAACATTAATCCCGAGGATGGAATGGC
AGACTATAGTGATCCCTCTTACGTGAAGCAGATGGAAAGAGAATCCCGAGAACATCTCCG
TTTAGGGTTGTTGGGCCTTCCTGCCCCTAAGAATGATTTTGAAATTGTTCTACCAGAAAA
TGCCGAGAAGGAGCTGGAAGAACGTGAAATAGATGATACTTACATTGAAGATGCTGCTGA
TGTGGATGCTCGAAAGCAGGCCATACGAGATGCAGAGCGTGTAAAGGAAATGAAACGAAT
GCATAAAGCTGTCCAGAAAGATCTGCCAAGACCATCAGAAGTAAATGAAACTATTCTAAG
ACCCTTAAATGTAGAACCGCCTTTAACAGATTTACAGAAAAGTGAAGAACTAATCAAAAA
AGAAATGATCACAATGCTTCATTATGACCTTCTACATCACCCTTATGAACCATCTGGAAA
TAAAAAAGGCAAAACTGTAGGGTTTGGTACCAATAATTCAGAGCACATTACCTATCTGGA
ACATAATCCTTATGAAAAGTTCTCCAAAGAAGAGCTGAAAAAGGCCCAGGATGTTTTGGT
GCAGGAGATGGAAGTGGTTAAACAAGGAATGAGCCATGGAGAGCTCTCAAGTGAAGCTTA
TAACCAGGTGTGGGAAGAATGCTACAGTCAAGTTTTATATCTTCCTGGGCAGAGCCGCTA
CACACGGGCCAATCTGGCTAGTAAAAAGGACAGAATTGAATCACTTGAAAAGAGGCTCGA
GATAAACAGGGGTCACATGACGACAGAAGCCAAGAGGGCTGCAAAGATGGAAAAGAAGAT
GAAAATTTTGCTTGGGGGTTACCAGTCTCGTGCTATGGGGCTCATGAAACAGTTGAATGA
CTTATGGGACCAAATTGAACAGGCTCACTTGGAGTTACGCACTTTTGAAGAACTCAAGAA
ACATGAAGATTCTGCTATTCCCCGGAGGCTAGAGTGTCTAAAAGAAGACGTTCAGCGACA
ACAAGAAAGAGAAAAGGAACTTCAACATAGATATGCTGATTTGCTGCTGGAGAAAGAGAC
TTTAAAGTCAAAATTCTGAAGTACAGTTTATATTCTGTCACAGGATTAATTAATTGCCGG
TTTTCATACTCTAGAAGGCTGAAACTGATGTTTATCTTCATTGACAAATTTACCCACCAT
CTGTGGTTTTTCAGTTGTTTATTTTAAATGATATCGATCTTACACATTCTGTGTATAAAG
ACCTTAACTCCACAGGACGGACATTTTAGAGTTTAAATTATTAAGGCTATCATTCTTTTA
GTAATGTCATATTTGCAAACTTTTTTAGTTTTGGCCTTTAATTTAAAAAGCCTAATTTTA
AAGTGCTGCCTGTGAGTAACTCTTGAATAAAAACAAAATATAAAAAATTGAGAATGTAGC
CTTTTGTTTGAAGTAATTAGATACTTAAGAGTGCCTGCAAACCAGCAGCTATGTACTCTG
TGTCATATTTAATGAGTAACTCTTGGGTAATCAAAATGGTGATGCAGTATCTTAAACACT
TAAGAGGCAGTTCTTTGTGGCTTTGTTAGTTTCAGCAAAGAGTGGTCATTTCTGTATACA
CTGACAAGTTAGATTAACTTTTTAGTACCTCAAATTTTTTTTTTGTTAATATCACTTTAA
AGAAGGTCTCTTGTCTGCCAGCTACTTAAATAATTTATGGGTCAGGGCTTAAAAGATTTA
ACTTCCTTGCCCCATTATTTTCTTATAAGTATTTTTTGACAAAGGCATTTTAAAAGTTAA
TTTCAAGAAGGCCATCAAACTTAAAGCTCTATGTTTAGCCTAAGAAGTCAGTTACATCAG
TGTAGAATTTGGGGAATGGATAGAGGTGGAGATATTTAATTTTATATAATTCATATAAAT
TGATTTAGTTACAGTATCAGTTGGCTACAAGCTCATTATAGACTAGCAATGTTTTGACAT
CACCAAAAACGTTTGCCCAGTCTTAGAATACTAGGGACTATAGGAAGGGAAGGGATTCAT
TCATTCATTCGATATTGAATGTATACCCTGTGCCAGAGTCTTAGAGAGAGAACAACAAAC
AAAATAGGCCTAGTTCTTGTTTAGTAGAGCTTATAGTCTTTTGAGAATGACAGACAATTA
AAATCCAAATGTTTATTTGGTGATTCTTATGTGTCAGACACTTAAGTGTTGGGAGATAAG
CAGTTATTAAGACAGAGTTCTTGCTCTCATGGAGGTGACATTAGTGGGGAGGAGATACTA
AGTATGTCCAGGGAAAGTATCAGACCATGAGTTTTAGATTCTGTGGAGGAAATTAAAGTA
GGGTGATTATGAGATAGTGAATGAGTGGCTATTTTAGACTGGACGATCAAAGAGACCTCT
TGGAAGGCAGCTATGCTCACCACTATACCACTGCACTGTGCCGCACCGTACCACTATAAG
CTGCACGGCCAAAGAGACCTCTTAAAGAAGTAACATTTAAGATAACATGTGATTGACATT
TTAGAATGGGCTATCCTTGTGAGATTCAAGGAAAGAACATCCTAGGTGGAGTGAATAGCA
AACATAAAGCCTCTTTTGTATGTTTGAGGAACAAAAAGGACAATGCAGCTAGAGTGTCAA
GAATGGCATTTCTGTATATAAGACCTCGTTGTATAGAGCCACATAAATAAGGCTATAATA
AGGAATTTGGATCTTACTTTAAATATGATAAGAATCGATGAGAAGATCTAAGCAAAGGAA
TGACATGATCAGATTTGGTTTTAGAAACATCACTATCTCCTTAGTGTGTAAAATCTCACC
AGGCTGGAGATAGGGAAGCCAGTCCAATTAGGAGCCTGATGCAGTGATCCAGACAAAAAA
ATAATAGTGATTCTAACTAGAGTCCAGGTAATAGTAGTGGAGATATGTGGAGAGACATGA
TAGGTATATACTTAATAGTCTTATCAGACGATAAATTGATATTTTCCTGGTGTGTAGTCA
CTTAATTCAAATACTTTTTTCAGTAAGTTCTGGGTTTTCTAGGAAAAACTTCAGTATCAT
CAGTGAATAATGATAGTGTTTCTTCTGATAGTTTTATTTCACTTTTATTGCATGTTTTGT
TATCTGAAATGTTTAGGACAATGTTAACAATAATGATGTTAGACATTTTTTTTTCTTATT
TTAATGGGAATGTCCATAGTTTTAAGTTTGCTGTTGGGAGTTAGATAGTCTTTATCTGAA
AGACAGTGTCTCTCTTTTAGTTTTTAAAGAGTTTGAATTAGAAATGGCTCTGGAACTTTA
AACAGTATACCATTTGGGCATCTATTAAAGCATTCATATAATTGTTCTCATTTGATGTTT
TGATGAGGTATATTAATAGATTTTCCCACATTAAATCATCTTTGCACTCCTGGAATCAGG
TAGATTAATTTTTAAAAGAAATTTTAAAGGATTTATAGTTTATTTGCACTTTTTGTAGAC
TTGAATTATATGGATTTAAAAGTTGATCTAATATTAATAAAGGCTCACTTTGTTTTCAAA
ATTTGAAGTAATTCACATACTTATAGCCTAAAAAAATCGGCAGGAATTACAAAATTTCAA
AACTGGCACATTGTAAACTGCATATGCATTTGCCAGGTAGTGGTGCCACTTGAAATGGTG
AACAGACACACTGTTATCCTTTGTCAGTATCCTGTAAAGCCCAGGATTCTTTACCAGCAC
CATACAGCGATTTTGGTGACTATTTTAACATTCACACTGAGGCCAGGGGTGGTGAGTCAT
GCCTGTAATCCTAGCACTTTGGGAGGCCAAGGTGGGAGGATCATTTGAGCTCAGGAGTTC
AAGATTAGCCTGGGTAACATAGTGAGACCCTGTCTCTATTAAAAAATAATAATAAAAATA
ACATTCACATTGGTATTGTTCACTAAGGTATTGGTTGTTAAGGCATTCATTAAGGTATTG
TTAAAACTTGTGTTAAGCATGTTAAAGTCTCAGTAACTTTGGGATAGAAATAAAATGTGA
TAAAAAGCTGAAAGAAACCACCACAAGGGAGAGTCCTTTTTGAAATATTAGAGACATAAT
GCTGTCTAATAAAAAACGACATCAAAGAAAAACTACACTACAGTGACTGCAGACTTAATG
TTGGCCAACCATGCATCCTCCCTAGAAATGCATTTGAATTTGATTTACTAATCTTTTATT
TAGGAAATTTACATTTTTACATTAGTGAGATTGGTCTTTTGGGCTATTGTACTTTTTTTT
TTTTTTTTTTGAGATGGAGTCTTGCTCTCTCACCCAGGCTGGAGTGCAGTAGTGCAATCT
TGGCCCACTGCAACCTCTGCCTCCTGGGCTCGAGTGATTCTCTGCCTCAGCCTTCCAAGT
AGCTGGGACTACAGGCATGTGCCACCGCACCTGGCTAATTTTTGTGTTTTTAGTAGAGAT
GGGGTTTTGCTATGTTGGCCAGGCTGGTCTTGAATTCCTGACCTCAGGTGATCCACCTAC
CTCGGCCTCCCAAAGTGCTAGAATTACAGGTGTGAGCCACCATGCCCAGCCTGGTTATTG
TATTTTGATATTGGGATTTTGCTAGCTCTCTAAAGTAAATAGGATAACTGTATATCTTTT
TCTGTGCATTAAGCAGTTATAACATGGGAATGATTTGTTCATGAAAGGTTGAAAGTCTGT
ACTTACAGAACTTTTGAGTTCACAGTGCTTTCTGGAAATAATTTCTTTATAACTGTCAGT
TTCTTTTGTGACTATTATGTTACCTATTTTTAAATTTAAGCAACTTTAAATTAAAAAAAT
TGTTTTTAAAAT

Protein Sequence

>988 : length: 802
MPRIMIKGGVWRNTEDEILKAAVMKYGKNQWSRIASLLHRKSAKQCKARWYEWLDPSIKK
TEWSREEEEKLLHLAKLMPTQWRTIAPIIGRTAAQCLEHYEFLLDKAAQRDNEEETTDDP
RKLKPGEIDPNPETKPARPDPIDMDEDELEMLSEARARLANTQGKKAKRKAREKQLEEAR
RLAALQKRRELRAAGIEIQKKRKRKRGVDYNAEIPFEKKPALGFYDTSEENYQALDADFR
KLRQQDLDGELRSEKEGRDRKKDKQHLKRKKESDLPSAILQTSGVSEFTKKRSKLVLPAP
QISDAELQEVVKVGQASEIARQTAEESGITNSASSTLLSEYNVTNNSVALRTPRTPASQD
RILQEAQNLMALTNVDTPLKGGLNTPLHESDFSGVTPQRQVVQTPNTVLSTPFRTPSNGA
EGLTPRSGTTPKPVINSTPGRTPLRDKLNINPEDGMADYSDPSYVKQMERESREHLRLGL
LGLPAPKNDFEIVLPENAEKELEEREIDDTYIEDAADVDARKQAIRDAERVKEMKRMHKA
VQKDLPRPSEVNETILRPLNVEPPLTDLQKSEELIKKEMITMLHYDLLHHPYEPSGNKKG
KTVGFGTNNSEHITYLEHNPYEKFSKEELKKAQDVLVQEMEVVKQGMSHGELSSEAYNQV
WEECYSQVLYLPGQSRYTRANLASKKDRIESLEKRLEINRGHMTTEAKRAAKMEKKMKIL
LGGYQSRAMGLMKQLNDLWDQIEQAHLELRTFEELKKHEDSAIPRRLECLKEDVQRQQER
EKELQHRYADLLLEKETLKSKF