ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

9869

Name

SETDB1

Synonym

ESET|H3-K9-HMTase4|KG1T|KMT1E|TDRD21;SET domain, bifurcated 1;SETDB1;SET domain, bifurcated 1

Definition

ERG-associated protein with SET domain|ERG-associated protein with a SET domain, ESET|H3-K9-HMTase 4|histone H3-K9 methyltransferase 4|histone-lysine N-methyltransferase SETDB1|histone-lysine N-methyltransferase, H3lysine-9 specific 4|lysine N-methyltrans

Position

1q21

Gene Type

protein-coding

Pathways and Diseases

Pathway

Noncanonical Wnt signaling pathway;PID Curated;200016

Pathway

Lysine degradation;KEGG PATHWAY;hsa00310

Disease

Tropical spastic paraparesis;FunDO

Disease

Huntington disease;FunDO

External Links

Links to cell senescence gene database

9869

Links to epithelial mesenchymal transition gene database

9869

Links to ovarian cancer gene database

9869

Links to endometrial cancer gene database

9869

Links to iHOP

9869

Sequence Information

Nucleotide Sequence

>9869 : length: 4606
GGCACTAAAGGTTTGCTTCCGGGCGTTTCTTTTGCTTCCCCTTCCCTCTTTCACGCTTCC
TCCCCTCCCCCTCCTCCCTTATCCCTTCGCTTTCGCTCTTTTCCGTCGAGGCCGACCCCT
GAGTTGTGAGTCTGGGGTCTGGTTGGTGAAAAAGAGCCCTTGAAGCTGGAAGACGGGAGA
GGACAAAAGCATGTCTTCCCTTCCTGGGTGCATTGGTTTGGATGCAGCAACAGCTACAGT
GGAGTCTGAAGAGATTGCAGAGCTGCAACAGGCAGTGGTTGAGGAACTGGGTATCTCTAT
GGAGGAACTTCGGCATTTCATCGATGAGGAACTGGAGAAGATGGATTGTGTACAGCAACG
CAAGAAGCAGCTAGCAGAGTTAGAGACATGGGTAATACAGAAAGAATCTGAGGTGGCTCA
CGTTGACCAACTCTTTGATGATGCATCCAGGGCAGTGACTAATTGTGAGTCTTTGGTGAA
GGACTTCTACTCCAAGCTGGGACTACAATACCGGGACAGTAGCTCTGAGGACGAATCTTC
CCGGCCTACAGAAATAATTGAGATTCCTGATGAAGATGATGATGTCCTCAGTATTGATTC
AGGTGATGCTGGGAGCAGAACTCCAAAAGACCAGAAGCTCCGTGAAGCTATGGCTGCCTT
AAGAAAGTCAGCTCAAGATGTTCAGAAGTTCATGGATGCTGTCAACAAGAAGAGCAGTTC
CCAGGATCTGCATAAAGGAACCTTGAGTCAGATGTCTGGAGAACTAAGCAAAGATGGTGA
CCTGATAGTCAGCATGCGAATTCTGGGCAAGAAGAGAACTAAGACTTGGCACAAAGGCAC
CCTTATTGCCATCCAGACAGTTGGGCCAGGGAAGAAATACAAGGTGAAATTTGACAACAA
AGGAAAGAGTCTACTGTCGGGGAACCATATTGCCTATGATTACCACCCTCCTGCTGACAA
GCTGTATGTGGGCAGTCGGGTGGTCGCCAAATACAAAGATGGGAATCAGGTCTGGCTCTA
TGCTGGCATTGTAGCTGAGACACCAAACGTCAAAAACAAGCTCAGGTTTCTCATTTTCTT
TGATGATGGCTATGCTTCCTATGTCACACAGTCGGAACTGTATCCCATTTGCCGGCCACT
GAAAAAGACTTGGGAGGACATAGAAGACATCTCCTGCCGTGACTTCATAGAGGAGTATGT
CACTGCCTACCCCAACCGCCCCATGGTACTGCTCAAGAGTGGCCAGCTTATCAAGACTGA
GTGGGAAGGCACGTGGTGGAAGTCCCGAGTTGAGGAGGTGGATGGCAGCCTAGTCAGGAT
CCTCTTCCTGGATGACAAAAGATGTGAGTGGATCTATCGAGGCTCTACACGGCTGGAGCC
CATGTTCAGCATGAAAACATCCTCAGCCTCTGCACTGGAGAAGAAGCAAGGACAGCTCAG
GACACGTCCAAATATGGGTGCTGTGAGGAGCAAAGGCCCTGTTGTCCAGTACACACAGGA
TCTGACCGGTACTGGAACCCAGTTCAAGCCAGTGGAACCCCCACAGCCTACAGCTCCACC
TGCCCCACCTTTCCCACCTGCTCCACCTCTATCCCCCCAAGCAGGTGACAGTGAAAGCTT
GGAAAGCCAGCTTGCCCAGTCACGGAAGCAGGTAGCCAAAAAGAGCACGTCCTTTCGACC
AGGATCTGTGGGCTCTGGTCATTCCTCCCCTACATCTCCTGCACTCAGTGAAAATGTCTC
TGGTGGGAAACCTGGGATCAACCAGACATATAGATCACCTTTAGGCTCCACAGCCTCTGC
CCCAGCACCCTCAGCACTCCCGGCCCCTCCAGCACCCCCAGTCTTCCATGGCATGCTGGA
GCGGGCCCCAGCAGAGCCCTCCTACCGTGCTCCCATGGAGAAGCTTTTCTACTTACCTCA
TGTCTGCAGCTATACCTGTCTGTCTCGAGTCAGACCTATGAGGAATGAGCAGTACCGGGG
CAAGAACCCTCTGCTGGTCCCGTTACTATATGACTTCCGGCGGATGACAGCCCGGCGTCG
AGTTAACCGCAAGATGGGCTTTCATGTTATCTATAAGACACCTTGTGGTCTCTGCCTTCG
GACAATGCAGGAGATAGAACGCTACCTTTTCGAGACTGGCTGTGACTTCCTCTTCCTGGA
GATGTTCTGTTTGGATCCATATGTTCTTGTGGACCGAAAGTTTCAGCCCTATAAGCCTTT
TTACTATATTTTGGACATCACTTATGGGAAGGAAGATGTTCCCCTATCCTGTGTCAATGA
GATTGACACAACCCCTCCACCCCAGGTGGCCTACAGCAAGGAACGTATCCCGGGCAAGGG
TGTTTTCATTAACACAGGCCCTGAATTTCTGGTTGGCTGTGACTGCAAGGATGGGTGTCG
GGACAAGTCCAAGTGTGCCTGCCATCAACTAACTATCCAGGCTACAGCCTGTACCCCAGG
AGGCCAAATCAACCCTAACTCTGGCTACCAGTACAAGAGACTAGAAGAGTGTCTACCCAC
AGGGGTATATGAGTGTAACAAACGCTGCAAATGTGACCCAAACATGTGCACAAACCGGTT
GGTGCAACATGGACTACAAGTTCGGCTACAGCTATTCAAGACACAGAACAAGGGCTGGGG
TATCCGCTGCTTGGATGACATTGCCAAAGGCTCTTTTGTTTGTATTTATGCAGGCAAAAT
CCTGACAGATGACTTTGCAGACAAGGAGGGTCTGGAAATGGGTGATGAGTACTTTGCAAA
TCTGGACCATATCGAGAGCGTGGAGAACTTCAAAGAAGGATATGAGAGTGATGCCCCCTG
TTCCTCTGACAGCAGTGGTGTAGACTTGAAGGACCAGGAAGATGGCAACAGCGGTACAGA
GGACCCTGAAGAGTCCAATGATGATAGCTCAGATGATAACTTCTGTAAGGATGAGGACTT
CAGCACCAGTTCAGTGTGGCGGAGCTATGCTACCCGGAGGCAGACCCGGGGCCAGAAAGA
GAACGGACTCTCTGAGACAACTTCCAAGGACTCCCACCCCCCAGATCTTGGACCCCCACA
TATTCCTGTTCCTCCCTCAATCCCTGTAGGTGGCTGCAATCCACCTTCCTCCGAAGAGAC
ACCCAAGAACAAGGTGGCCTCATGGTTGAGCTGCAATAGTGTCAGTGAAGGTGGTTTTGC
TGACTCTGATAGCCATTCATCCTTCAAGACTAATGAAGGTGGGGAGGGCCGGGCTGGGGG
AAGCCGAATGGAGGCTGAGAAGGCCTCCACCTCAGGACTAGGCATCAAGGATGAGGGAGA
CATCAAACAGGCCAAGAAAGAGGACACTGACGACCGAAACAAGATGTCAGTAGTTACTGA
AAGCTCTCGAAATTACGGTTACAATCCTTCTCCTGTGAAGCCTGAAGGACTTCGCCGCCC
ACCTAGTAAGACTAGTATGCATCAAAGCCGAAGACTCATGGCTTCTGCTCAGTCCAACCC
TGATGATGTCCTGACACTGTCCAGCAGCACAGAAAGTGAGGGGGAAAGTGGGACCAGCCG
AAAGCCCACTGCTGGTCAGACTTCGGCTACAGCGGTTGACAGTGATGATATCCAGACCAT
ATCCTCTGGCTCTGAAGGGGATGACTTTGAGGACAAGAAGAACATGACTGGTCCAATGAA
GCGTCAAGTGGCAGTAAAATCAACCCGAGGCTTTGCTCTTAAATCAACCCATGGGATTGC
AATTAAATCAACCAACATGGCCTCTGTGGACAAGGGGGAGAGCGCACCTGTTCGTAAGAA
CACACGCCAATTCTATGATGGCGAGGAGTCTTGCTACATCATTGATGCCAAGCTTGAAGG
CAACCTGGGCCGCTACCTCAACCACAGTTGCAGCCCCAACCTGTTTGTCCAGAATGTCTT
CGTGGATACCCATGATCTTCGCTTCCCCTGGGTGGCCTTCTTTGCCAGCAAAAGAATCCG
GGCTGGGACAGAACTTACTTGGGACTACAACTACGAGGTGGGCAGTGTGGAAGGCAAGGA
GCTACTCTGTTGCTGTGGGGCCATTGAATGCAGAGGACGTCTTCTTTAGAGGACAGCCTT
CTTCCCAACCCTTCTTGAACTGTCGTTTCCTCAGGAACTGGGTCTTCCTGATTGTTGAAC
CCTGACCCGAAGTCTCTGGGCTAGCTACTCCCCCCAGCTCCTAGTTGATAGAAATGGGGG
TTCTGGACCAGATGATCCCTTCCAATGTGGTGCTAGCAGGCAGGATCCCTTCTCCACCTC
CAAAGGCCCTAAAGGGTGGGGAGAGATCACCACTCTAACCTCGGCCTGACATCCCTCCCA
TCCCATATTTGTCCAAGTGTTCCTGCTTCTAACAGACTTTGTTCTTAGAATGGAGCCTGT
GTATCTACTATCTCCAGTTTGTATTATTTCTTGAAAGTCTTTTAACAATATGATAAAACT
AAGATTGTGGTTTTGTTTCTCTCTCTCAGCCCGATACTCCCAATTCTGGATCTTTCAGTG
AGGTATTATCCCCATCCTCCCCTGTGGGCTGCTGTCATTCATCTTCTACCTTGTCTACCT
TTGCTTCTTGCATGTGAATTTTTTTAGATGGAGTTCTCGCTCTGTC

Protein Sequence

>9869 : length: 1292
MSSLPGCIGLDAATATVESEEIAELQQAVVEELGISMEELRHFIDEELEKMDCVQQRKKQ
LAELETWVIQKESEVAHVDQLFDDASRAVTNCESLVKDFYSKLGLQYRDSSSEDESSRPT
EIIEIPDEDDDVLSIDSGDAGSRTPKDQKLREAMAALRKSAQDVQKFMDAVNKKSSSQDL
HKGTLSQMSGELSKDGDLIVSMRILGKKRTKTWHKGTLIAIQTVGPGKKYKVKFDNKGKS
LLSGNHIAYDYHPPADKLYVGSRVVAKYKDGNQVWLYAGIVAETPNVKNKLRFLIFFDDG
YASYVTQSELYPICRPLKKTWEDIEDISCRDFIEEYVTAYPNRPMVLLKSGQLIKTEWEG
TWWKSRVEEVDGSLVRILFLDDKRCEWIYRGSTRLEPMFSMKTSSASALEKKQGQLRTRP
NMGAVRSKGPVVQYTQDLTGTGTQFKPVEPPQPTAPPAPPFPPAPPLSPQAGDSESLESQ
LAQSRKQVAKKSTSFRPGSVGSGHSSPTSPALSENVSGGKPGINQTYRSPLGSTASAPAP
SALPAPPAPPVFHGMLERAPAEPSYRAPMEKLFYLPHVCSYTCLSRVRPMRNEQYRGKNP
LLVPLLYDFRRMTARRRVNRKMGFHVIYKTPCGLCLRTMQEIERYLFETGCDFLFLEMFC
LDPYVLVDRKFQPYKPFYYILDITYGKEDVPLSCVNEIDTTPPPQVAYSKERIPGKGVFI
NTGPEFLVGCDCKDGCRDKSKCACHQLTIQATACTPGGQINPNSGYQYKRLEECLPTGVY
ECNKRCKCDPNMCTNRLVQHGLQVRLQLFKTQNKGWGIRCLDDIAKGSFVCIYAGKILTD
DFADKEGLEMGDEYFANLDHIESVENFKEGYESDAPCSSDSSGVDLKDQEDGNSGTEDPE
ESNDDSSDDNFCKDEDFSTSSVWRSYATRRQTRGQKENGLSETTSKDSHPPDLGPPHIPV
PPSIPVGGCNPPSSEETPKNKVASWLSCNSVSEGGFADSDSHSSFKTNEGGEGRAGGSRM
EAEKASTSGLGIKDEGDIKQAKKEDTDDRNKMSVVTESSRNYGYNPSPVKPEGLRRPPSK
TSMHQSRRLMASAQSNPDDVLTLSSSTESEGESGTSRKPTAGQTSATAVDSDDIQTISSG
SEGDDFEDKKNMTGPMKRQVAVKSTRGFALKSTHGIAIKSTNMASVDKGESAPVRKNTRQ
FYDGEESCYIIDAKLEGNLGRYLNHSCSPNLFVQNVFVDTHDLRFPWVAFFASKRIRAGT
ELTWDYNYEVGSVEGKELLCCCGAIECRGRLL