ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

9846

Name

GAB2

Synonym

GRB2-associated binding protein 2;GAB2;GRB2-associated binding protein 2

Definition

GRB2-associated-binding protein 2|Grb2-associated binder 2|growth factor receptor bound protein 2-associated protein 2|pp100

Position

11q14.1

Gene Type

protein-coding

Pathways and Diseases

Pathway

IL2 signaling events mediated by STAT5;PID Curated;200158

Pathway

Fc epsilon RI signaling pathway;KEGG PATHWAY;hsa04664

Pathway

TCR signaling in naive CD4+ T cells;PID Curated;200022

Pathway

Chronic myeloid leukemia;KEGG PATHWAY;hsa05220

Pathway

Fc gamma R-mediated phagocytosis;KEGG PATHWAY;hsa04666

Pathway

PDGF signaling pathway;PANTHER;P00047

Pathway

Fc-epsilon receptor I signaling in mast cells;PID Curated;200003

Pathway

Neurotrophic factor-mediated Trk receptor signaling;PID Curated;200128

Pathway

EGF receptor signaling pathway;PANTHER;P00018

Pathway

IL2-mediated signaling events;PID Curated;200082

Pathway

Signaling in Immune system;Reactome;REACT:6900

Pathway

Signaling events mediated by Hepatocyte Growth Factor Receptor (c-Met);PID Curated;200032

Pathway

GMCSF-mediated signaling events;PID Curated;200015

Pathway

IL2 signaling events mediated by PI3K;PID Curated;200099

Disease

Alzheimer's disease (late onset);GAD

Disease

Alzheimer's disease (late onset);NHGRI

Disease

Multiple myeloma;FunDO

Disease

Ovarian cancer;FunDO

Disease

Leukemia;FunDO

Disease

Rheumatoid arthritis;FunDO

Disease

Breast cancer;FunDO

Disease

NEUROLOGICAL;GAD

External Links

Links to cell senescence gene database

9846

Links to epithelial mesenchymal transition gene database

9846

Links to ovarian cancer gene database

9846

Links to endometrial cancer gene database

9846

Links to iHOP

9846

Sequence Information

Nucleotide Sequence

>9846 : length: 6149
AGCTGCCCGAGCCCGCGCCCTCGTCCGCGCGACCCGGCGGGGGGCTCCAGGCCGGCAGCA
TGAGCGGCGGCGGCGACGTGGTGTGCACCGGCTGGCTGAGGAAATCGCCTCCCGAGAAGA
AGTTGAGGCGCTATTACCTTCTGTCTGACTTCAACCCCACATCTGCTTGACAAGAATTAA
CTCAAATATCTCTTCTTAACACCTACCTGATTCTGGCATACAGCCTGGAAGAAACGCTGG
TTTATCCTGCGGAGTGGCCGGATGAGCGGTGACCCAGATGTTCTGGAATACTACAAGAAC
GATCACTCCAAGAAGCCTCTGCGGATCATCAACCTGAACTTCTGTGAGCAGGTAGATGCA
GGCCTGACCTTTAACAAGAAGGAGCTGCAGGATAGTTTTGTGTTTGACATCAAGACCAGT
GAACGCACCTTTTACCTGGTGGCTGAGACAGAAGAGGACATGAATAAGTGGGTCCAGAGC
ATCTGCCAGATCTGTGGCTTCAATCAGGCTGAGGAGAGCACAGACTCCCTGAGAAATGTT
TCCTCAGCCGGTCATGGCCCCCGCTCTTCTCCAGCTGAGCTCAGCAGCTCTAGCCAGCAC
CTTCTCCGAGAGCGCAAGTCCTCAGCCCCATCACACTCCAGCCAGCCAACTCTGTTCACG
TTTGAACCCCCTGTGTCAAACCACATGCAGCCCACCTTGTCCACCAGCGCACCTCAGGAG
TATCTCTACTTGCACCAGTGCATAAGCCGAAGAGCAGAAAATGCAAGGAGTGCCAGCTTC
TCTCAGGGCACCAGAGCCTCTTTTCTCATGAGGAGTGACACAGCTGTACAAAAACTTGCC
CAGGGCAATGGACACTGTGTCAACGGGATCAGTGGTCAAGTCCATGGCTTCTATAGCCTT
CCCAAGCCGAGCCGGCACAATACAGAATTCAGAGACAGTACCTACGACCTCCCCCGCAGC
CTGGCCTCCCATGGCCACACCAAGGGCAGCCTCACAGGCTCCGAGACAGATAATGAGGAT
GTGTACACCTTCAAGACGCCCAGCAACACCCTGTGCAGGGAGTTCGGGGACCTCCTGGTA
GACAATATGGATGTTCCGGCCACCCCACTCTCAGCCTACCAGATCCCTAGGACATTCACT
CTGGACAAAAACCACAATGCCATGACAGTGGCCACTCCTGGGGACTCAGCCATAGCTCCC
CCACCCCGCCCCCCCAAGCCAAGTCAGGCAGAAACACCTCGATGGGGCAGTCCTCAGCAG
AGACCGCCAATCAGTGAAAATAGCAGATCTGTCGCTGCCACCATCCCCAGACGCAACACC
CTCCCTGCAATGGACAACAGCCGACTTCACCGAGCTTCTTCCTGTGAGACCTACGAGTAC
CCACAGCGTGGTGGAGAGAGTGCAGGCCGGTCTGCTGAATCCATGAGTGATGGAGTTGGC
TCTTTCCTGCCAGGGAAAATGATTGTGGGCCGATCGGACAGCACCAATTCTGAAGACAAC
TATGTGCCCATGAATCCAGGTTCTTCCACCCTGTTGGCCATGGAACGAGCAGGTGATAAT
TCCCAGAGCGTCTACATCCCAATGAGCCCAGGGGCCCATCACTTTGACTCACTTGGCTAC
CCATCAACAACCCTTCCTGTGCACCGAGGCCCCAGCAGAGGAAGTGAGATTCAGCCACCC
CCTGTCAACCGCAACCTCAAACCTGATCGGAAAGCAAAGCCAACACCACTTGACCTGAGG
AACAACACCGTCATCGATGAACTCCCCTTCAAGTCACCTATCACCAAGTCTTGGTCTAGG
GCCAACCACACCTTCAACTCCAGCTCCTCCCAGTACTGCCGCCCCATCTCCACCCAGAGC
ATCACCAGCACAGACTCAGGAGACAGCGAAGAGAACTATGTCCCTATGCAAAACCCAGTG
TCTGCATCTCCCGTTCCCAGTGGCACGAACAGTCCTGCCCCTAAGAAGAGCACCGGCAGC
GTTGATTATCTGGCCCTGGACTTCCAGCCGAGCTCCCCAAGCCCCCACCGCAAGCCATCT
ACTTCATCCGTCACCTCTGATGAGAAGGTGGACTACGTTCAGGTGGACAAGGAGAAGACC
CAGGCCCTGCAGAACACCATGCAGGAGTGGACAGACGTGCGGCAGTCCTCAGAGCCTTCC
AAGGGTGCCAAGCTGTGATGAGAGGGCCACCGCAGAGCCCAGGAGGCAGCATCTCCAGAG
CTGGCCCTTCCCATCTCCCCTCTCCCCTCTCCCGTTCTTCCTCCCATCCACCTCCTCTCT
ACTCTGCCAGTCTCAGCCTTCAAAGCACTTGACATCAGGGACCCTGAACCCTTCCCCTGG
GAGGTGAGGGCCTGATCAAGGCACCTCCTCTGCCCACTCGGGGCCCAGCTGTGATTTTTA
TCAGTAATGGCCATGCCTCCACCCACCTTAGTTAGGAGCTACTTCCAAAAAGCATCCTTC
AGCCTCTTCCTGTCCTTTAGACCTGACTCTCTACCAGATGTTTGGAGGGAAGGGCTGGGG
CTCTGAGCCAGATTCCACACCTCACGTTCAGTCACAGCCCTCAGCTATCTTCCCTCCGGC
CACTGGGCTACCTCTCCTTCAGTCCCAGAAGACAAGTCTCACCAACCCAGGGAGTCAAGG
ACCAGCAAACCAAAGTGGATAATGGACTTTTTCATTCCTGTTTTTCTTGGCAGGAGAGAA
GCAAGGCCACTAAAAGAGGAGATGGTGGAGACGGAGGCTCAGCAGTGGTCTTGAGGGGTA
AAGGACTTAGATGCCCAGATGAAGAGGGAAAGCTGACATCTGCAGGGAACCCACTTTGAG
GCTGAGGCCATGGCAGGACAGCTGCTGTGGGGTGCAGAGGCAGAAGATGAAGGACAAAAG
GAAGGGAAAACTGATGGCCAACCTAGAGCAGCAAGGAGCAGGGCTTGGAGCTCGGGTGGT
GGAGATGACAAGGACACTGTGGGGTCTGGGTCCCCAGAACTCTGGAGCTACAGGCCACTC
TAGGCCCAAGGGCTAGTCCTCTTCCCCAGTCCCCTCAGAGGCCCCCGCCAGCCCCACCTT
GAAAGCAGCATACAGGGGAAGGCTTGGACCAAGCTGGGCGACCAAGCACATGGGGCAGGA
ACACATGGTAAAGGGGTGGGGAATATGGGAGGGAGTGTGGTGTGGATGGGGGTGATGCAG
GGACTGAGGGGAACCCTGGGACAGGCACAGGCTGGGCAGAGGCACAGGGCAGTGCAGGGG
ACTCTGCAGTGGGGTCGGGAAGTGAGTTTCTTTGCAGTGAGCAGTGCAGTGGAAGTCGGG
CACAGAGGTAGCAGACAGATGTGAAGCAGTGGTGAAGGCCATGTAGCAAGTGGGGAAATA
CATCCAAAGGGCCTGGGAGTTGGGGGGTGCCCAACGCAATCCTTGGGGGTGCAGGGTGGA
GCAGAAAGTGAAGGAGGGACACGTGCAAGAGTGGTGTGCATGGTGGTGTGACATGAGGAC
CGTTCCTAGGATGGGACAGTGGGTCAGGCAGGACAAGGAGAAAGCAGGGCAGAATGATGC
CTAGAGGACCACATCAGGCATGGCTGACAGCTTGTGCCCATGGGCTGTGGCGTATGTCAG
ATCGCAGGGTAGGAACGAGTCTGGCCTGGTGCCGGCCCAGTGTTTCCTCAGCTCATCCGC
CCTCTGTTGCTCCCTAGCATTCCAGGAGCCATCTTGGACTCTCCTCCCCAGGTTTGAAAG
GCCATCAGATTAGCAGGGACGGGGTGTAGGGCATCACCCAAGGTTCCTTCTCTTAAACTA
AGGGTGGGGGATCTGAATGTTTTTATGTTGACTGTTCTTGACTAAATTTTCAAGAGTTTC
AGAAGCAACAGGACAGACCAGACGTTTCATTCTACCCTGGGGCGAACAGAACTTCTTCCT
CCCAAACAATGACTTCCTGCCATGTTTGATGGGGACAGCTACCACTGTCCTCTGCCCCCA
TTCCCCTTTCAGCTCCCATGAGCATGCATAGTTCACCAGACCAATGGCCTAGCCATTCTC
TAAGTCCCATCCTGGAAGAAGTTATTTCTTCAAGAGCTGCACCTCTCCTCCTAGCATTAG
TTTAGATCAACTCAAGGAGTATTTATTAATGGCTGCTGTCTCCAGTTTCTGGGGTTAAGC
ACTAAGGACACAAGAATCAATCAGACCTTCTCCCTGAACTTAAGATAGCCACAATCAGAA
AAAGGACAAGGACATGAGACAGTGGTGATGGCCATCAGACAGAGACTTCAAATGCTGATG
GAGGGCAGAGGAAGTACTTAGGGAGGTTGGTGTCAGAGGCAGGAGTGGGGGATCAGGGAA
GGTGGATTCTAGGAAAAGGGAGTGCCTGAGGTAGGCCTTAGAAGGGGATGAGTCAGATTT
TTACAGAGGAGGAGGGCAGGGCTTGGGTCCAGTGGAGGAAGAAGGAAGGAGAGGCTTGGA
AAGCCTTGTGTCTTGGGAACAAAAGGCCTTTGAGCATATGGGTCCAGCCACTCAGAAGTG
TAGGGGCCATGCCTTGGTGTTCCAATAAGTGAATGGAAGCAGTGGTGGTAGCTACACTGG
GCAGAGTTGGCAGGGTGCTGGTTCACTCTGCCCAGCCCTGAATGTGTGCCTTAAAGGCCC
CCTACAAGGGGCCCCATACGACAGAGCTTTTAACTGGTGCCTTCCCTGTACCCGCAGCAG
CCACAAGTGGGCCCAGACTATTGCAGCCTCCCATAAACATGTGAGCATGTTCTGAGTGTG
CCATGATGTGAGTGGACCTGGCTGGAATCTTCGGAGAGCGACTGAGGTGTTCAAATCGAA
TCTCCCAGGAGGCTTCCTTCCAGCCCCCTATTCTGGTAACTACCAGGAGGCTTCCTTCCA
GCCCCCTATTCTGGTAACTACCAAAATCCCTCGGGTGCAAGTGTAGGGGTAGAGATGGAA
GGATGAGAGGTGAAATTGACCTTTTGAAAGCAAAGCTCTGGCTCACAGGCCCCAAACTAC
CAGCCGTATCTAGCATATCCCCACCCTCCACCCACTACCTCCTCCAACAAAGGAGTCAAC
TCAGTTGAAAAAACTGGTCCTTTGGCCTATCCATGGGTCAAAGTCCACCTCTCCTGGGGG
CCTGGAGAGGACTGAGCCTACGGAAAGGGGATACCTTCCCACTCAGCACTGCTTCACACA
GGCCCCCTGCCTGGGGCTCTCCAAGGAGCCTTCTTCACCCACTTCCAGCTCCACTTCTGC
AAGGTTAAGTCAAGTGAGAACGATGAGAAATAGGGAGATGGTGTCTCCTTAAGTCCTTGA
TCTGCCTGTCTGTGGAATGGGAGGTTGGATTAGCTGCGCTGAGGTCCCATCCACAGCTGG
TGCTCAGCTGCTTGAAGGGGAGACTCCCTCCTCTGTAACTTCTTTCTGGGGGATTGGGGT
GGGCAGTACCTATCCCCAGTCCCCTCCTAGCTTGACTTTAGTGGTTTCCAATGTAGAAGT
TAACAAAGTATGCCCCATTCCTGTGACAAAAGCACAACCATTCTGAAGTTACTGGAGCAT
GGGCTCAGCTCATCCTCCCTCTGGCCCCTTCTCCCATGGGGACATCTCGGCCCAGCACCC
CTATCCCATTTCCAGAGTTCTTCCTTCCCCATCTGGGCCTTCATAAAATGCAGGGGAAGC
CAGACTGGTCTCAGGAGCGCTAAAGCCCTTCCGTGGGGGGTCGTCTTTCTGGGACTAGCC
CTGCTGTTTAGGACCTGGGACCACAATGGGGTACCTGCCGAGGGGGTCCCCAAGAGATCC
AGGCTGTCATGTGATTTATGGTGGCATGTGTTGTGTATTTGTTGGCTACTTGTGTCTTGA
AATCTAGAATTATTTCACGCAGAATTGTCACTGTTTGTCAGGAAGAGAAAATGGGCTAGT
GGAAGCCCAGTCTTGAGTTCTTGTCTTGTTACCATTTAAAATTGACATTTAATTTTCAAA
TCACTGTTGGTGCCTAATCACTTAAGTTATTAATTTATTCTGTTGTATTCTTTTTTTTAA
ATTGTAACATATTTATCCGGTGGGTGGGACAGGAGTGTGTTCAAGTGGGTCATGTTTTTG
CTGTGGTGACACATGGTACAGGCTTGGAGCTTGCAGGTCCCTTTCTACTGTGGTGTTGGA
GCAGGACAATAAAGTCCACTAGAAATGCA

Protein Sequence

>9846 : length: 676
MSGGGDVVCTGWLRKSPPEKKLRRYAWKKRWFILRSGRMSGDPDVLEYYKNDHSKKPLRI
INLNFCEQVDAGLTFNKKELQDSFVFDIKTSERTFYLVAETEEDMNKWVQSICQICGFNQ
AEESTDSLRNVSSAGHGPRSSPAELSSSSQHLLRERKSSAPSHSSQPTLFTFEPPVSNHM
QPTLSTSAPQEYLYLHQCISRRAENARSASFSQGTRASFLMRSDTAVQKLAQGNGHCVNG
ISGQVHGFYSLPKPSRHNTEFRDSTYDLPRSLASHGHTKGSLTGSETDNEDVYTFKTPSN
TLCREFGDLLVDNMDVPATPLSAYQIPRTFTLDKNHNAMTVATPGDSAIAPPPRPPKPSQ
AETPRWGSPQQRPPISENSRSVAATIPRRNTLPAMDNSRLHRASSCETYEYPQRGGESAG
RSAESMSDGVGSFLPGKMIVGRSDSTNSEDNYVPMNPGSSTLLAMERAGDNSQSVYIPMS
PGAHHFDSLGYPSTTLPVHRGPSRGSEIQPPPVNRNLKPDRKAKPTPLDLRNNTVIDELP
FKSPITKSWSRANHTFNSSSSQYCRPISTQSITSTDSGDSEENYVPMQNPVSASPVPSGT
NSPAPKKSTGSVDYLALDFQPSSPSPHRKPSTSSVTSDEKVDYVQVDKEKTQALQNTMQE
WTDVRQSSEPSKGAKL