ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

983

Name

CDK1

Synonym

CDC2|CDC28A|P34CDC2;cyclin-dependent kinase 1;CDK1;cyclin-dependent kinase 1

Definition

cell cycle controller CDC2|cell division control protein 2 homolog|cell division cycle 2, G1 to S and G2 to M|cell division protein kinase 1|p34 protein kinase

Position

10q21.1

Gene Type

protein-coding

Pathways and Diseases

Pathway

Signaling in Immune system;Reactome;REACT:6900

Pathway

Recruitment of NuMA to mitotic centrosomes;PID Reactome;500382

Pathway

Signaling by Insulin receptor;Reactome;REACT:498

Pathway

Axon guidance;Reactome;REACT:18266

Pathway

Retinoic acid receptors-mediated signaling;PID Curated;200142

Pathway

cell cycle: g1/s check point;PID BioCarta;100160

Pathway

FOXM1 transcription factor network;PID Curated;200120

Pathway

Phosphorylation of the APC/C;PID Reactome;500395

Pathway

E2F-enabled inhibition of pre-replication complex formation;PID Reactome;500374

Pathway

Signaling by PDGF;Reactome;REACT:16888

Pathway

akap95 role in mitosis and chromosome dynamics;PID BioCarta;100247

Pathway

Loss of Nlp from mitotic centrosomes;PID Reactome;500384

Pathway

cell cycle: g2/m checkpoint;PID BioCarta;100159

Pathway

ERK1 activation;PID Reactome;500085

Pathway

Cdc20:Phospho-APC/C mediated degradation of Cyclin A;PID Reactome;500491

Pathway

Cyclin B2 mediated events;PID Reactome;500975

Pathway

APC/C:Cdc20 mediated degradation of Cyclin B;PID Reactome;500397

Pathway

regulation of splicing through sam68;PID BioCarta;100036

Pathway

Signalling by NGF;Reactome;REACT:11061

Pathway

rb tumor suppressor/checkpoint signaling in response to dna damage;PID BioCarta;100046

Pathway

PLK1 signaling events;PID Curated;200087

Pathway

E2F transcription factor network;PID Curated;200027

Pathway

p53 pathway;PANTHER;P00059

Pathway

protein kinase a at the centrosome;PID BioCarta;100246

Pathway

Chk1/Chk2(Cds1) mediated inactivation of Cyclin B:Cdk1 complex;PID Reactome;500318

Pathway

Progesterone-mediated oocyte maturation;KEGG PATHWAY;hsa04914

Pathway

Phosphorylation of Emi1;PID Reactome;500392

Pathway

how progesterone initiates the oocyte maturation;PID BioCarta;100104

Pathway

AP-1 transcription factor network;PID Curated;200118

Pathway

regulation of cell cycle progression by plk3;PID BioCarta;100068

Pathway

cdc25 and chk1 regulatory pathway in response to dna damage;PID BioCarta;100212

Pathway

Cell cycle;KEGG PATHWAY;hsa04110

Pathway

Phosphorylation of proteins involved in the G2/M transition by Cyclin A:Cdc2 complexes;PID Reactome;500930

Pathway

Signaling by EGFR;Reactome;REACT:9417

Pathway

G2/M DNA replication checkpoint;PID Reactome;500939

Pathway

Gap junction;KEGG PATHWAY;hsa04540

Pathway

stathmin and breast cancer resistance to antimicrotubule agents;PID BioCarta;100027

Pathway

cyclins and cell cycle regulation;PID BioCarta;100207

Pathway

sonic hedgehog receptor ptc1 regulates cell cycle;PID BioCarta;100060

Pathway

Cell Cycle Checkpoints;Reactome;REACT:1538

Pathway

Cyclin A/B1 associated events during G2/M transition;PID Reactome;500991

Pathway

Cdc20:Phospho-APC/C mediated degradation of Cyclin A;Reactome;REACT:6850

Pathway

Regulation of APC/C activators between G1/S and early anaphase;PID Reactome;500391

Pathway

Oocyte meiosis;KEGG PATHWAY;hsa04114

Pathway

p53 signaling pathway;KEGG PATHWAY;hsa04115

Pathway

Loss of proteins required for interphase microtubule organization from the centrosome;PID Reactome;500383

Pathway

Cell Cycle, Mitotic;Reactome;REACT:152

Disease

Dementia;GAD

Disease

Alzheimer's disease;GAD

Disease

NEUROLOGICAL;GAD

External Links

Links to cell senescence gene database

983

Links to epithelial mesenchymal transition gene database

983

Links to ovarian cancer gene database

983

Links to endometrial cancer gene database

983

Links to iHOP

983

Sequence Information

Nucleotide Sequence

>983 : length: 1999
TTGAAACTGCTCGCACTTGGCTTCAAAGCTGGCTCTTGGAAATTGAGCGGAGAGCGACGC
GGTTGTTGTAGCTGCCGCTGCGGCCGCCGCGGAATAATAAGCCGGGTACAGTGGCTGGGG
TCAGGGTCGTGTCTAGGGGACGGCCGAGGGCCTCGGAGGGCGAGTATTGAGGAACGGGGT
CCTCTAAGAAGGCCGGACTGGAGGATCTACCATACCCATTGACTAACTATGGAAGATTAT
ACCAAAATAGAGAAAATTGGAGAAGGTACCTATGGAGTTGTGTATAAGGGTAGACACAAA
ACTACAGGTCAAGTGGTAGCCATGAAAAAAATCAGACTAGAAAGTGAAGAGGAAGGGGTT
CCTAGTACTGCAATTCGGGAAATTTCTCTATTAAAGGAACTTCGTCATCCAAATATAGTC
AGTCTTCAGGATGTGCTTATGCAGGATTCCAGGTTATATCTCATCTTTGAGTTTCTTTCC
ATGGATCTGAAGAAATACTTGGATTCTATCCCTCCTGGTCAGTACATGGATTCTTCACTT
GTTAAGAGTTATTTATACCAAATCCTACAGGGGATTGTGTTTTGTCACTCTAGAAGAGTT
CTTCACAGAGACTTAAAACCTCAAAATCTCTTGATTGATGACAAAGGAACAATTAAACTG
GCTGATTTTGGCCTTGCCAGAGCTTTTGGAATACCTATCAGAGTATATACACATGAGGTA
GTAACACTCTGGTACAGATCTCCAGAAGTATTGCTGGGGTCAGCTCGTTACTCAACTCCA
GTTGACATTTGGAGTATAGGCACCATATTTGCTGAACTAGCAACTAAGAAACCACTTTTC
CATGGGGATTCAGAAATTGATCAACTCTTCAGGATTTTCAGAGCTTTGGGCACTCCCAAT
AATGAAGTGTGGCCAGAAGTGGAATCTTTACAGGACTATAAGAATACATTTCCCAAATGG
AAACCAGGAAGCCTAGCATCCCATGTCAAAAACTTGGATGAAAATGGCTTGGATTTGCTC
TCGAAAATGTTAATCTATGATCCAGCCAAACGAATTTCTGGCAAAATGGCACTGAATCAT
CCATATTTTAATGATTTGGACAATCAGATTAAGAAGATGTAGCTTTCTGACAAAAAGTTT
CCATATGTTATATCAACAGATAGTTGTGTTTTTATTGTTAACTCTTGTCTATTTTTGTCT
TATATATATTTCTTTGTTATCAAACTTCAGCTGTACTTCGTCTTCTAATTTCAAAAATAT
AACTTAAAAATGTAAATATTCTATATGAATTTAAATATAATTCTGTAAATGTGTGTAGGT
CTCACTGTAACAACTATTTGTTACTATAATAAAACTATAATATTGATGTCAGGAATCAGG
AAAAAATTTGAGTTGGCTTAAATCATCTCAGTCCTTATGGCAGTTTTATTTTCCTGTAGT
TGGAACTACTAAAATTTAGGAAAATGCTAAGTTCAAGTTTCGTAATGCTTTGAAGTATTT
TTATGCTCTGAATGTTTAAATGTTCTCATCAGTTTCTTGCCATGTTGTTAACTATACAAC
CTGGCTAAAGATGAATATTTTTCTACTGGTATTTTAATTTTTGACCTAAATGTTTAAGCA
TTCGGAATGAGAAAACTATACAGATTTGAGAAATGATGCTAAATTTATAGGAGTTTTCAG
TAACTTAAAAAGCTAACATGAGAGCATGCCAAAATTTGCTAAGTCTTACAAAGATCAAGG
GCTGTCCGCAACAGGGAAGAACAGTTTTGAAAATTTATGAACTATCTTATTTTTAGGTAG
GTTTTGAAAGCTTTTTGTCTAAGTGAATTCTTATGCCTTGGTCAGAGTAATAACTGAAGG
AGTTGCTTATCTTGGCTTTCGAGTCTGAGTTTAAAACTACACATTTTGACATAGTGTTTA
TTAGCAGCCATCTAAAAAGGCTCTAATGTATATTTAACTAAAATTACTAGCTTTGGGAAT
TAAACTGTTTAACAAATAA

Protein Sequence

>983 : length: 297
MEDYTKIEKIGEGTYGVVYKGRHKTTGQVVAMKKIRLESEEEGVPSTAIREISLLKELRH
PNIVSLQDVLMQDSRLYLIFEFLSMDLKKYLDSIPPGQYMDSSLVKSYLYQILQGIVFCH
SRRVLHRDLKPQNLLIDDKGTIKLADFGLARAFGIPIRVYTHEVVTLWYRSPEVLLGSAR
YSTPVDIWSIGTIFAELATKKPLFHGDSEIDQLFRIFRALGTPNNEVWPEVESLQDYKNT
FPKWKPGSLASHVKNLDENGLDLLSKMLIYDPAKRISGKMALNHPYFNDLDNQIKKM