ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

9820

Name

CUL7

Synonym

3M1|KIAA0076|dJ20C7.5;cullin 7;CUL7;cullin 7

Definition

CUL-7|cullin-7

Position

6p21.1

Gene Type

protein-coding

Pathways and Diseases

Pathway

Diabetes pathways;Reactome;REACT:15380

Pathway

Ubiquitin mediated proteolysis;KEGG PATHWAY;hsa04120

Disease

3-M syndrome;OMIM

External Links

Links to cell senescence gene database

9820

Links to epithelial mesenchymal transition gene database

9820

Links to ovarian cancer gene database

9820

Links to endometrial cancer gene database

9820

Links to iHOP

9820

Sequence Information

Nucleotide Sequence

>9820 : length: 5613
AAAGAAGGAGGTGCTGCGTCGCCAAGGTGGCATCCTCGGCTCCGCCCCGGCGCTCTCCCA
GGGCCCCTAGCTTTCCGCTGGGTCGGGCGGAAATGAGCCGTGGCTTTTGGCTGGCGGAGC
CGCTGGCAGGGACCGGGCCCCACCCTGCCCCAGTGGCTGCCGACTCACGCGGGTGCAGCT
CTGTTCCGCGGAGGCACGCCCCCTCCCGTCTCTCCGTCTCGACCCCCTCGCGGGGCCCAG
GTGGGGCCCAAGTCGCCGCCAGCGTCTGTGCCGCGTCCCTTGCTCTGTGAAGGACAGGCC
TCGCGCCAGGACCCCGGTGGACTTCTGAGGTGCCAGGATGGTGGGAGAACTCCGCTACAG
GGAATTCAGGGTGCCCCTGGGGCCCGGCTTACATGCCTATCCTGATGAGCTGATCCGCCA
GCGCGTGGGCCATGATGGGCATCCTGAGTACCAGATCCGTTGGCTCATCCTGCGGCGTGG
CGATGAGGGGGACGGGGGCTCTGGCCAAGTGGACTGCAAGGCTGAGCACATCCTGCTGTG
GATGTCCAAGGATGAGATCTATGCCAACTGCCACAAGATGCTGGGCGAGGATGGCCAGGT
CATCGGGCCCTCCCAGGAGTCTGCAGGGGAGGTTGGGGCCCTGGACAAATCTGTGCTGGA
GGAGATGGAAACCGACGTGAAGTCCCTCATTCAGAGAGCCCTTCGGCAGCTGGAGGAGTG
TGTGGGCACTATCCCTCCTGCTCCTCTACTTCACACTGTCCACGTGCTCAGCGCCTATGC
CAGCATTGAGCCCCTCACTGGAGTATTCAAGGACCCAAGGGTCCTGGACTTGCTCATGCA
CATGTTGAGTAGTCCTGATTATCAGATTCGCTGGAGTGCAGGCCGGATGATACAAGCCCT
GTCCTCCCATGACGCTGGTGAGGGGCAGTGTGGGGAGGAAGGGAAAGCAGGAGAAGGGCT
GGGTCGGCTCAGGGACTCACAGGACACTGTGGCAGGAGCCTCTGATCTCATCAGGACCCG
GACTCAGATCCTTCTGTCACTGAGCCAACAAGAAGCCATTGAGAAACACCTGGATTTTGA
CAGCCGCTGTGCTCTGCTAGCACTGTTTGCACAGGCCACGCTCTCTGAACACCCCATGTC
TTTCGAGGGCATTCAGCTACCACAGGTCCCAGGAAGGGTGCTCTTCTCCCTGGTGAAGCG
GTATTTGCATGTCACCTCGCTCCTGGATCAGCTGAACGACAGTGCTGCGGAGCCAGGAGC
CCAGAACACCTCTGCTCCTGAGGAGTTGAGTGGGGAGAGGGGTCAACTGGAGCTGGAGTT
CAGTATGGCCATGGGCACCCTGATCTCGGAGCTGGTGCAAGCCATGCGCTGGGACCAGGC
CTCAGACAGACCAAGGAGCTCAGCACGGTCCCCCGGTTCCATCTTCCAGCCTCAGCTGGC
AGATGTGAGCCCAGGGCTCCCCGCTGCCCAGGCTCAGCCCTCCTTCAGGAGGTCAAGACG
TTTTCGCCCTCGTTCTGAGTTCGCAAGTGGCAATACCTATGCTTTGTATGTGCGGGACAC
ACTGCAGCCGGGGATGCGAGTGCGGATGCTGGATGATTATGAGGAGATCAGTGCCGGGGA
TGAGGGCGAGTTTCGGCAGAGCAACAACGGTGTGCCTCCTGTGCAGGTATTTTGGGAGTC
AACAGGCCGCACCTATTGGGTGCACTGGCACATGCTGGAGATCTTGGGCTTTGAGGAAGA
CATTGAGGACATGGTTGAGGCTGATGAGTACCAAGGGGCAGTGGCCAGTAGAGTCCTGGG
TAGAGCCCTGCCTGCCTGGCGCTGGAGGCCCATGACAGAACTCTATGCTGTGCCTTATGT
GCTGCCTGAGGATGAGGACACTGAGGAGTGTGAACACCTGACCCTGGCTGAGTGGTGGGA
ACTCCTCTTCTTCATCAAGAAGCTGGATGGACCTGACCATCAGGAGGTTCTCCAGATCCT
CCAGGAGAACCTAGATGGGGAGATTCTGGATGATGAGATCCTAGCTGAACTGGCCGTGCC
CATAGAATTGGCCCAGGACTTGCTGCTGACTCTGCCACAGCGACTCAATGACAGTGCCCT
CAGGGACCTGATCAACTGCCATGTCTACAAGAAGTATGGGCCTGAAGCCCTAGCAGGGAA
CCAAGCCTACCCATCCCTTCTAGAAGCCCAAGAAGATGTCCTCCTGCTAGACGCGCAGGC
CCAGGCTAAGGACTCAGAAGATGCAGCCAAAGTGGAAGCAAAAGAACCCCCATCTCAGAG
TCCCAACACTCCCCTGCAGCGTCTGGTGGAGGGTTATGGTCCAGCTGGGAAAATCCTCCT
GGATCTAGAGCAAGCCCTCAGCTCAGAGGGGACCCAGGAGAACAAGGTCAAGCCACTCCT
GCTGCAGCTGCAGCGGCAGCCGCAGCCCTTCCTGGCACTGATGCAGAGCCTGGACACTCC
GGAGACTAACAGGACCCTGCACCTGACTGTGCTGAGAATCCTGAAGCAGCTGGTGGACTT
CCCCGAGGCACTGCTGCTCCCCTGGCACGAGGCCGTGGATGCCTGCATGGCCTGCCTGCG
GTCCCCAAACACTGATCGAGAGGTGCTCCAGGAACTGATTTTCTTCCTGCACCGCCTGAC
CTCAGTGAGCAGGGACTATGCCGTGGTGCTGAATCAGCTGGGAGCAAGAGACGCTATCTC
CAAGGCCCTGGAAAAGCACCTGGGAAAGCTGGAGCTGGCTCAGGAGCTGCGGGACATGGT
GTTCAAGTGTGAGAAGCATGCCCACCTCTACCGCAAACTCATCACCAACATCCTGGGAGG
CTGCATCCAGATGGTGCTGGGCCAGATCGAAGACCACAGACGAACCCACCAACCCATCAA
CATCCCTTTCTTTGATGTGTTCCTCAGATACCTGTGCCAGGGCTCCAGTGTGGAAGTGAA
GGAGGACAAGTGCTGGGAGAAGGTGGAGGTGTCCTCCAACCCGCACCGGGCCAGCAAGCT
GACGGACCACAACCCCAAGACCTATTGGGAGTCCAACGGCAGCGCCGGCTCCCACTACAT
CACCCTGCACATGCGCCGGGGCATCCTCATCAGGCAACTGACTCTGCTTGTGGCTAGTGA
GGACTCGAGTTACATGCCGGCCCGAGTGGTGGTGTGCGGGGGTGATAGCACTAGCTCTCT
TCACACGGAACTCAACTCGGTGAATGTGATGCCCTCTGCCAGCCGGGTGATCCTCCTGGA
GAACCTGACCCGCTTCTGGCCCATCATCCAGATCCGCATAAAGCGCTGCCAGCAGGGTGG
CATTGATACGCGCATTCGGGGGTTAGAGATCCTAGGCCCCAAGCCCACGTTCTGGCCAGT
GTTCCGGGAGCAGCTCTGTCGTCACACACGCCTCTTCTACATGGTTCGGGCACAGGCCTG
GAGCCAGGACATGGCAGAGGACCGCAGGAGCCTCCTGCACCTGAGTTCTAGACTCAACGG
TGCTCTGCGCCAGGAGCAGAATTTTGCTGACCGCTTCCTCCCTGATGACGAGGCTGCCCA
AGCTCTGGGCAAGACCTGCTGGGAGGCCCTGGTCAGCCCCGTGGTGCAGAACATCACCTC
CCCTGATGAGGATGGCATTAGCCCCCTGGGTTGGCTGCTGGACCAGTACCTGGAGTGTCA
GGAAGCTGTCTTCAACCCCCAGAGCCGCGGCCCAGCTTTCTTCTCGCGGGTGCGCCGTCT
CACTCACCTGCTGGTGCATGTCGAGCCCTGTGAGGCACCCCCTCCTGTGGTGGCCACTCC
TCGGCCCAAAGGCAGAAACAGAAGCCACGACTGGAGCTCCTTGGCTACCCGGGGCCTTCC
AAGCAGCATCATGAGAAACCTGACGCGCTGTTGGCGGGCCGTGGTGGAGAAGCAGGTGAA
CAATTTTCTGACCTCATCCTGGCGGGATGATGACTTTGTGCCACGCTACTGTGAGCACTT
TAATATTCTGCAGAACTCAAGCTCTGAACTGTTTGGGCCTCGGGCAGCCTTCTTGCTGGC
GCTGCAAAATGGCTGTGCGGGAGCCTTGCTGAAGCTCCCTTTTCTCAAAGCTGCCCACGT
GAGTGAGCAGTTCGCCCGGCACATTGACCAGCAGATCCAGGGCAGCCGGATCGGTGGAGC
CCAGGAAATGGAGAGGCTGGCACAGCTGCAGCAATGCCTGCAAGCTGTCCTGATTTTCTC
CGGCTTGGAGATAGCCACCACTTTTGAGCATTATTACCAGCACTACATGGCGGACCGTCT
CCTGGGCGTGGTCTCGAGCTGGCTGGAGGGGGCCGTGCTGGAGCAGATCGGTCCCTGCTT
CCCCAACCGCCTCCCCCAGCAGATGTTGCAGAGCCTGAGCACCTCTAAGGAGCTGCAGCG
CCAGTTCCACGTCTACCAGCTCCAGCAGCTGGATCAGGAACTCCTGAAGCTGGAGGATAC
AGAGAAGAAAATACAGGTGGGCCTTGGGGCCAGTGGCAAGGAGCACAAGAGCGAGAAGGA
AGAGGAAGCTGGGGCAGCAGCAGTGGTGGATGTGGCGGAGGGAGAGGAGGAAGAGGAGGA
GAATGAGGACCTCTACTATGAAGGGGCAATGCCAGAAGTGTCTGTGCTTGTCCTGTCCCG
ACACTCCTGGCCTGTTGCCTCAATCTGCCACACACTGAACCCCAGAACCTGCCTGCCCTC
CTACCTGAGGGGCACTTTGAACAGATACTCCAACTTCTACAACAAGAGTCAGAGCCACCC
TGCCCTTGAGCGAGGCTCACAGAGGCGACTGCAGTGGACGTGGCTGGGCTGGGCTGAGCT
GCAGTTTGGGAACCAGACCCTGCATGTGTCCACCGTGCAGATGTGGCTACTGCTGTATCT
CAACGACCTGAAGGCGGTCTCTGTGGAGAGTCTGCTGGCGTTCTCAGGGCTCTCCGCAGA
CATGCTCAATCAGGCGATTGGGCCCCTCACCTCTTCAAGAGGCCCCCTGGACCTTCACGA
GCAAAAGGATATACCAGGAGCATTTATTTCAGGGGTCCTCAAGATTCGAGATGGCAGCAA
GGAACCCAGGTCGAGATGGGACATTGTGCGGCTCATCCCACCTCAGACGTACCTGCAAGC
TGAGGGTGAAGACGGCCAGAACTTGGAGAAGAGACGGAATCTTCTGAACTGCCTCATCGT
CCGAATCCTCAAGGCCCATGGAGATGAGGGGCTGCACATTGACCAGCTTGTCTGTCTGGT
GCTGGAGGCTTGGCAGAAGGGCCCGTGTCCTCCCAGGGGTTTGGTCAGCAGCCTTGGTAA
GGGGTCTGCATGCAGCAGCACTGACGTCCTCTCCTGCATCCTACACCTCCTGGGCAAGGG
CACGCTGAGACGCCATGACGACCGGCCCCAGGTGCTGTCCTATGCAGTCCCTGTGACTGT
CATGGAGCCTCACACTGAGTCCCTGAACCCAGGCTCCTCAGGCCCCAACCCACCCCTCAC
CTTCCATACCCTACAGATTCGCTCCCGGGGTGTGCCCTATGCCTCCTGCACTGCCACCCA
GAGCTTCTCTACCTTCCGGTAGCCCTAGACTTGGGGTCAGGGGAAGGTAGAGCTGGAGCT
TTTACAGAAATAAAACCCAAGAGTTTGATTATA

Protein Sequence

>9820 : length: 1786
MSRGFWLAEPLAGTGPHPAPVAADSRGCSSVPRRHAPSRLSVSTPSRGPGARMVGELRYR
EFRVPLGPGLHAYPDELIRQRVGHDGHPEYQIRWLILRRGDEGDGGSGQVDCKAEHILLW
MSKDEIYANCHKMLGEDGQVIGPSQESAGEVGALDKSVLEEMETDVKSLIQRALRQLEEC
VGTIPPAPLLHTVHVLSAYASIEPLTGVFKDPRVLDLLMHMLSSPDYQIRWSAGRMIQAL
SSHDAGEGQCGEEGKAGEGLGRLRDSQDTVAGASDLIRTRTQILLSLSQQEAIEKHLDFD
SRCALLALFAQATLSEHPMSFEGIQLPQVPGRVLFSLVKRYLHVTSLLDQLNDSAAEPGA
QNTSAPEELSGERGQLELEFSMAMGTLISELVQAMRWDQASDRPRSSARSPGSIFQPQLA
DVSPGLPAAQAQPSFRRSRRFRPRSEFASGNTYALYVRDTLQPGMRVRMLDDYEEISAGD
EGEFRQSNNGVPPVQVFWESTGRTYWVHWHMLEILGFEEDIEDMVEADEYQGAVASRVLG
RALPAWRWRPMTELYAVPYVLPEDEDTEECEHLTLAEWWELLFFIKKLDGPDHQEVLQIL
QENLDGEILDDEILAELAVPIELAQDLLLTLPQRLNDSALRDLINCHVYKKYGPEALAGN
QAYPSLLEAQEDVLLLDAQAQAKDSEDAAKVEAKEPPSQSPNTPLQRLVEGYGPAGKILL
DLEQALSSEGTQENKVKPLLLQLQRQPQPFLALMQSLDTPETNRTLHLTVLRILKQLVDF
PEALLLPWHEAVDACMACLRSPNTDREVLQELIFFLHRLTSVSRDYAVVLNQLGARDAIS
KALEKHLGKLELAQELRDMVFKCEKHAHLYRKLITNILGGCIQMVLGQIEDHRRTHQPIN
IPFFDVFLRYLCQGSSVEVKEDKCWEKVEVSSNPHRASKLTDHNPKTYWESNGSAGSHYI
TLHMRRGILIRQLTLLVASEDSSYMPARVVVCGGDSTSSLHTELNSVNVMPSASRVILLE
NLTRFWPIIQIRIKRCQQGGIDTRIRGLEILGPKPTFWPVFREQLCRHTRLFYMVRAQAW
SQDMAEDRRSLLHLSSRLNGALRQEQNFADRFLPDDEAAQALGKTCWEALVSPVVQNITS
PDEDGISPLGWLLDQYLECQEAVFNPQSRGPAFFSRVRRLTHLLVHVEPCEAPPPVVATP
RPKGRNRSHDWSSLATRGLPSSIMRNLTRCWRAVVEKQVNNFLTSSWRDDDFVPRYCEHF
NILQNSSSELFGPRAAFLLALQNGCAGALLKLPFLKAAHVSEQFARHIDQQIQGSRIGGA
QEMERLAQLQQCLQAVLIFSGLEIATTFEHYYQHYMADRLLGVVSSWLEGAVLEQIGPCF
PNRLPQQMLQSLSTSKELQRQFHVYQLQQLDQELLKLEDTEKKIQVGLGASGKEHKSEKE
EEAGAAAVVDVAEGEEEEEENEDLYYEGAMPEVSVLVLSRHSWPVASICHTLNPRTCLPS
YLRGTLNRYSNFYNKSQSHPALERGSQRRLQWTWLGWAELQFGNQTLHVSTVQMWLLLYL
NDLKAVSVESLLAFSGLSADMLNQAIGPLTSSRGPLDLHEQKDIPGAFISGVLKIRDGSK
EPRSRWDIVRLIPPQTYLQAEGEDGQNLEKRRNLLNCLIVRILKAHGDEGLHIDQLVCLV
LEAWQKGPCPPRGLVSSLGKGSACSSTDVLSCILHLLGKGTLRRHDDRPQVLSYAVPVTV
MEPHTESLNPGSSGPNPPLTFHTLQIRSRGVPYASCTATQSFSTFR