ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

9798

Name

IST1

Synonym

OLC1;increased sodium tolerance 1 homolog (yeast);IST1;increased sodium tolerance 1 homolog (yeast)

Definition

IST1 homolog|overexpressed in lung cancer 1|putative MAPK-activating protein PM28

Position

16q22.2

Gene Type

protein-coding

External Links

Links to cell senescence gene database

9798

Links to epithelial mesenchymal transition gene database

9798

Links to ovarian cancer gene database

9798

Links to endometrial cancer gene database

9798

Links to iHOP

9798

Sequence Information

Nucleotide Sequence

>9798 : length: 4154
ATGCGTAATTTCCTCTTTAGTAGAGACGGGGTTCCTCTGTGTTGGCCAGGCTGGTCTCGA
ATTACCGACTTCAGCGATGCGGTTTCACTATGGTGTCCAGGCTGGTCTGCAACTCCCGGG
CTCAAGCGATCCTCCCGCCCCGCCTCTCAAAGTGCTGGGAAGGTCCCTTCCAGGCTTAAG
CAGCGATAATGGTTTTCAAGTTAAAAACAAAGGAGGAACAGCACAGCATGCTGGGCTCTG
GATTTAAAGCTGAGCGCTTAAGAGTGAATTTGAGATTAGTCATAAATCGCCTTAAACTAT
TGGAGAAAAAGAAAACGGAACTGGCCCAGAAAGCAAGGAAGGAGATTGCTGACTATCTGG
CTGCTGGGAAAGATGAACGAGCTCGGATCCGTGTGGAGCACATTATCCGGGAAGACTACC
TCGTGGAGGCCATGGAGATCCTGGAGCTGTACTGTGACCTGCTGCTGGCTCGGTTTGGCC
TTATCCAGTCTATGAAGGAACTAGATTCTGGTCTGGCTGAATCTGTGTCTACATTGATCT
GGGCTGCTCCTCGACTCCAGTCAGAAGTGGCTGAGTTGAAAATAGTTGCTGATCAGCTCT
GTGCCAAGTATAGCAAGGAATATGGCAAGCTATGTAGGACCAACCAGATTGGAACTGTGA
ATGACAGGCTAATGCACAAGCTGAGTGTGGAAGCCCCACCCAAAATCCTGGTGGAGAGAT
ACCTGATTGAAATTGCAAAGAATTACAACGTACCCTATGAACCTGACTCTGTGGTCATGG
CAGAAGCTCCTCCTGGGGTAGAGACAGATCTTATTGATGTTGGATTCACAGATGATGTGA
AGAAAGGAGGCCCTGGAAGAGGAGGGAGTGGTGGCTTCACAGCACCAGTTGGTGGACCTG
ATGGAACGGTGCCAATGCCCATGCCCATGCCCATGCCTATGCCATCTGCAAATACGCCTT
TCTCATATCCACTGCCAAAGGGACCATCAGATTTCAATGGACTGCCAATGGGGACTTATC
AGGCCTTTCCCAATATTCATCCACCTCAGATACCAGCAACTCCCCCATCGTATGAATCTG
TAGATGACATTAATGCTGATAAGAATATCTCTTCTGCACAGATTGTTGGTCCTGGACCCA
AGCCAGAAGCCTCTGCAAAGCTTCCTTCCAGACCTGCAGATAACTATGACAACTTTGTCC
TACCAGAGTTGCCATCTGTGCCAGACACACTACCAACTGCATCTGCTGGTGCCAGCACCT
CAGCATCTGAAGACATTGACTTTGATGATCTTTCCCGGAGGTTTGAAGAGCTGAAAAAGA
AAACATAGGTCTCTTAAACCAGGCAACTTTCACGTTTTGGGAGTTGAGACTGAGCAATTT
CTCCTTGTAACAAAGAATCTCCATGAAATTCTGTTTCATCTGTTAACCGTCACTCAGCAC
AACACTCCCTCTGGGCTCTCTTCCTGCTCCTCCAGATTCTGCTGCTTTCCAGTTCTCTGT
TGATCCTGAGACTAACAATTGGAGACTGAGGCCAGAGCAACTGGCTCCTGGCAGCTGTGC
TTGTCCGTTTCCTGTCAGAGTGATCCCAGGTTTCCTCCTGGCCCGTCCCATGGTCCCTCC
ACAGGAGTGTGAGAGGATGGGGGAAGCACTGTGGGAAGACCACCAAAGATGGCTGGACAG
TGGGAGAGAGCACGTTGTGAAGCATCCCAGCCTCGTGTTGAGGTTCCAGACTTAGAAACA
GACCCCTCTGTACAGGGGGATTGTGGTGAGTGAGAATCAAGGCCACCTTGTGTGTTTTCT
CACTCTCGAATGCAAGTGGGAGAGGGAAAATGACTCGGGACGCCATTGTAACGGTTCCTG
GAAGCTGGGCCCTCTCATTGGCATATACAGTACTCCTCGCTGCAGGGCACTGTCCCACCG
GGATCCAGTTGCAAAGTTTGTCTTGACAGTTGAAGGCCTCGCTTAGTTGTACTGGATTCT
CAGGGAGCCCTCTGTGGCCTTTTGCTTTGCGTGCTGTTTCCCTTGTACCAGAGGGCGGCA
CCGTGGAAATTCTGTTTTCCCTGTAGCATATTGTGTTGGATTGCATTACTGGCAGAGAAA
GGACAAGGTGCCATTCAAGTCCTAGGGTGGGCTTCCAGCTGCCTTAATAGAAGTACTCAA
GTCTTTTGGGTAGTGAGCTGGAAAGCCTACAGGAAAAGAGGGGTACCTGTTTTCATTTGA
AAACTTTGATTCATGGAACCTTTAAAACTAATCTCAGAAAAATTTTTGGTGCCCATGCAG
CTGTAGTTGTTCACTGCTTTCCTGGATGGATGGGACTCTTATGTCATAACTTCTGTTACT
CCTTTGGCCCATAGCTAAGGTCATCCTTCCCCACAGGGGTGGCTTTGGGATTGGATGATA
CAGCTTTTGCTTCTGTGTAGTATACCTGTACATACTTGTTTCAGGCAGCCTTTCTTTAAT
GTTTTCAGTTGGTTTGTATTCTGTAGCTCAGTAGCTGCTAATAAAGTTAAAGATCCTGTG
TCCTGCTTTCTCTACTGTTTGGTCAGATGATGAAGTATAAATCTGGATTTTAGTGGAGAA
TATTTTAACCAAGTGATCCATGTAAACCAGCCCTTAGTTTCAGGATTCCTGGAGCAGTAC
AGAGCTCATTTTGATCTCTGTATTTAGATAGCCCAGATAGCATCTGTGAATTTCCTTGGT
CTTCCTCAGTGGCAGGGCTCCGCATCTGCCATGCCTCATCCTTGGATGTTTATTTTTAGT
AAGTTGCAGTGAGCTCACTTCTGACTGCTTCATTTCCCGCAGCCATCCTGGGCCATGGGT
GGTGAGTTCTGTTACTTGCTGCTTGGCAGCAGAGCTAGTTTGTCTCGTAGTATTCTTGCA
TTGTTAATCCTATCTTGACAGTGCCAAGATCCATAAGAACTTGGGACCAAGGGGATTTTG
ATTCCTAACTTACAGAATTAAAAACAAAGTATATTATAATTTTAAAGCTATGCCATGCAA
AGATAAGTAGTAATACGCTAATAAATACTAAGCCAAGTAGGAGATAACAGGATTAAGGTA
GTTCATCTAAAACTTCAGTGTCACTGCCCACTGCTGTCGTGGCTGCTTGCTCAGATGAGG
TTTTTTGGGGCCAACTGATTCCTAACAAATTTGAGAGCTTCTGTAGCAGTGTATCTATTA
GTGCAGCTTCTTTCTGAGTATTGAAGACAAAAAGAGAAAAGTGAGAAAATTGAAATTACT
GCTAATAGTGGAGTAAAAAAAGTACCAAAGATTTTTAAAAAATTAGTAAATGTAAAGATA
CTATTTCTTTAATAATTTGCAGTCAGGCATTGGAGTGTTTCCACTAATGGTTGCGAGCCA
ACTATTTATAGGACAATGGCTATAGAATATTATGTAGTCTTATAAATTGGGTTTCCTAGG
AAGATAGCTGGCAGAGCTTTTGAAACTAATAAAGGGAATATGATACTGTGCATTATAAAT
TATGTCAGCCCGTCATCTTAGGGGCAGTTACAGTGGAGCTTTCCCAGTGATATAACAGCA
TGCTAGTTTATCTTTTAGTTACCTACCTTAAGCGACTTTCTTTCTTTTCCAAAGGCCATG
AGAATGGCCGAAACGAAAAGATTAATTACCACAAGTACCATCAAGATGACACTGGTGAGG
ATCAGAAAGGTGCCCAGGACTGGGTCTAAAGCGAAAACCTGGGAAAACAATAAGAACACT
TGCAGTGACTGACAATTTAGTTTATACTTTACAAACATAAGCTATATGCTAGTGTTTGGG
ATCTTATCAGAAGAAAAGCTTATCCGAAGGAAACTTAGGGAGAGAGTCAAAAGATAATAA
GAAGGAAAATACTTTTAAATGGACAGAAGAGCAGGAATGACTCATTTTAAGGAGGTTAAG
ATAATTGTGACTGCAGGGCTTTCACAAGAAAACAGGTGAGTTGCAGTGGAATTGGAAATG
ATTCAAATGTCACATGAGTTTTGGCAAAAAATACATCTAATCATGGAAGCTAAAAGTGGG
AGGGGGGTAAGCAAACACTGAAAGATTAAATGCATACCAGAAATGAGAATGCACACTGTC
TCTGCCATATCAAGAAACTACAACCCTAAACACAGGAGCATTCCAATAAAAGTTAACAGG
TTGGCCACAGAAAA

Protein Sequence

>9798 : length: 379
MVFKLKTKEEQHSMLGSGFKAERLRVNLRLVINRLKLLEKKKTELAQKARKEIADYLAAG
KDERARIRVEHIIREDYLVEAMEILELYCDLLLARFGLIQSMKELDSGLAESVSTLIWAA
PRLQSEVAELKIVADQLCAKYSKEYGKLCRTNQIGTVNDRLMHKLSVEAPPKILVERYLI
EIAKNYNVPYEPDSVVMAEAPPGVETDLIDVGFTDDVKKGGPGRGGSGGFTAPVGGPDGT
VPMPMPMPMPMPSANTPFSYPLPKGPSDFNGLPMGTYQAFPNIHPPQIPATPPSYESVDD
INADKNISSAQIVGPGPKPEASAKLPSRPADNYDNFVLPELPSVPDTLPTASAGASTSAS
EDIDFDDLSRRFEELKKKT