ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

9792

Name

SERTAD2

Synonym

Sei-2|TRIP-Br2;SERTA domain containing 2;SERTAD2;SERTA domain containing 2

Definition

SERTA domain-containing protein 2|transcriptional regulator interacting with the PHD-bromodomain 2|transcriptional regulator interacting with the PHS-bromodomain 2

Position

2p14

Gene Type

protein-coding

External Links

Links to cell senescence gene database

9792

Links to epithelial mesenchymal transition gene database

9792

Links to ovarian cancer gene database

9792

Links to endometrial cancer gene database

9792

Links to iHOP

9792

Sequence Information

Nucleotide Sequence

>9792 : length: 6066
ATTGGGTAGCTCCGCTCCGCTCCGCCCCCTCAGCTCCTCACCCTCTCGTCGCCGCCTCCT
AGCTCACCTCTTTCTCGGCCCCCTTACCCCGCCCGTCCCCGCCGCATCACCCCTGTCCAG
CTGGGCGGGGATTGCTGTACGACTCTGTAAAGTCTGTGAGTCACTGCACAACCCATCAAT
CCAATTAAATGTCTTGAGCGAGCCGAGCAGGCGGTGCTGCCGCCCGCCGCCGCTCGCCCC
GCCGCGGCCGCCCCTGCTCCTGCTTGCAGCGCCCCTCTGATCCATGGCTGTCTGTCTGTA
CTTGTTACGGTGTAACATCCTCCTCCTCCTTCTCCTCCTCCTCCTCGGGAGCCGCTGCAA
CTTCCCCTCAGCCAGCCTCCTCCTCTGCCTGGGGACTGCAAAGGCATGGGATAGACCCAG
AGCCGCTTCCCTCTGTCTCCCCTCCAGCCCTCGCTCAATTTTCCCCCCTTTAAATTAAAG
TCTGTTCCTCGCTCCTCGTCGTTTTAGAGATTTATTGGTTGGTCTATTATTTCCCCTGAT
TTTATTTTCCCTCTCTGGGGCAGAGATCGTAGGGGCCGGTGGGTTTATTTTAGGGAGGGG
GCGCTCCATCACCCCACCCCTCCGTTTCTCCTTCTCCCTTTTCGGCCGTGACTTGATTTC
CCCGCTCCTCTGCGCTCCCACCCCTCGAACTCACCGTCCTGTACTCGAGTGACGCACAGA
CACCCCCCGCCCACAGCCCAGACGCCCCCTCCCTCGCTGCCACCCCGACCCGTCTCGGAG
CTGGACTGGGTGCCGACTTCTTCGCAGAAGGATATATGTTGGGTAAAGGAGGAAAACGGA
AGTTTGATGAGCATGAAGATGGGCTGGAAGGCAAAATCGTGTCTCCCTGTGACGGTCCAT
CCAAGGTGTCTTACACCTTACAGCGCCAGACTATCTTCAACATTTCCCTTATGAAACTCT
ATAACCACAGGCCCCTGACAGAGCCCAGCTTGCAAAAGACCGTTTTAATTAACAACATGT
TGAGGCGGATCCAGGAGGAACTCAAACAGGAAGGCAGCCTGAGGCCCATGTTCACCCCCT
CCTCCCAGCCCACCACCGAGCCCAGCGACAGCTACCGAGAGGCCCCGCCGGCCTTCAGCC
ACCTGGCGTCCCCGTCCTCCCACCCCTGCGACCTCGGAAGCACTACGCCCCTGGAGGCCT
GCCTCACCCCGGCCTCACTGCTCGAGGACGACGATGACACGTTTTGCACCTCCCAGGCCA
TGCAGCCCACGGCTCCCACCAAACTGTCACCTCCAGCCCTCTTGCCAGAAAAGGACAGTT
TCTCCTCTGCCTTGGACGAGATCGAGGAGCTCTGTCCCACATCTACCTCCACAGAGGCGG
CCACGGCTGCGACTGACAGTGTGAAAGGGACCTCCAGCGAGGCTGGCACCCAGAAACTCG
ACGGTCCTCAAGAGAGCCGCGCAGATGACTCAAAACTGATGGACTCTCTGCCTGGGAATT
TTGAAATAACGACGTCCACGGGTTTCCTGACAGACTTGACCCTGGATGACATCCTGTTTG
CTGACATTGATACGTCCATGTATGATTTTGACCCCTGCACTTCCTCATCAGGGACAGCCT
CAAAAATGGCCCCTGTGTCTGCCGACGACCTCCTCAAAACTCTGGCTCCTTACAGCAGTC
AGCCTGTCACCCCAAGTCAGCCTTTCAAAATGGACCTCACAGAGCTGGACCACATCATGG
AGGTGCTTGTTGGGTCCTAAGACCCAGGGACCCAGCGACTATGCCCACCCAGACCCCAGA
GCGTTCCCATAACCCTGACAGTTCTCCACACTGTGCATGCACCCTTGCTTGCCTTTTTCA
GAGAAAAAGAAAATTTTACAACAGGATCACACTAGTTTTTGCTTTGAGCAGAGTTGGAGT
GCCTTCATCCAAGTATGACCACTTTTAATACACTTTTTTGAGTGGTTCCTCAGAGACCTA
CTACCCTGGTATAGGAAAGAATCCATTTGAAGACAATGTTGCAATGTTGAATGACAAAAA
TAAACAGTTCAAGTGAAGCACAAGGATTAAGTTGGAAAAGCTGTAAATTGCATGTGCATA
TTTGTCTATTTTTTCTATAAGTTTTATTGCAAGAGGTAAAGAAGAAAACTATATATATAT
ATCTTATTTAGATAATCTCAGTACCTTTTCTGGCATTTTTGCCCTGTATAGGTTGACTTG
GCAATTCGGCCTTTTTAGAGGCATTAACTACTCCTCGTAAGTGTTGCATTTACATGGCTG
TTTAGAAAACTGCTGCCCAAATTTATTTTATATTTTTGTACAGATTCTGCAGTTTATGAT
ATTGTTTTTCTAAAAACAAATGCTGTTTATACATATGAGATAGCTATTTTGATAGGATTT
GCTCACATAGTTCCTGCAAACTTCAGATGTACAAGTTGCACTTGTACTTTTATAGAGTTG
TAATGTTTTATATGTGTATGGTGCAAGAGAAAATTGGATCAAATCAATCTGCAGTTGATG
TCCCCAAATGCAAACACAGGCACACACATGCACACACCCATAAACACACACACAGTGCTT
TAAGAAAGGGCCAGGTGATATCACACCCAAATTTCACAAGCACTGACCCCCTGGCACCAA
CACCCGCCAGTACTGTGACTTCCAAAGCCAGAGCCACATGTGCTCATCAAACTTGCATTA
AGCAGTTGGCGGGAGATGGCTGTGGAGCTGGGGGTTTAAGTGATGGTTCTCTTTTGCTCC
CTCTTTTGAGGGTAAAGCTACTGTCTTTCTTAAGAGTGTATTTATGCCAAGTTTGCGCTT
TTAATTGTTTTTATTTTGTTTTTTAATGAAAACCCAGATCTTTCCTTTTTGGCATAATTT
TTATGATGACCTGAAATTTTACATCCGAACAAAATTTTACATCCGAAAAGCAACCAACTT
CTTCATGGAACTCAGCCCTGTTGCAATGCTTAGGGCCCTTAAAGAAGAAAATCTCCCCAG
AAGGCATCCATCATGTTGCTTAATTGTCTTCTGCAGCTTCCTTTCCCTAGAGCTTTCCCT
GTGTTGCTAAGAGCTGAAAATGGCATCTTCGTGATCACCACAGTGAGCTTGGCTCGCCTC
GGCCGGCCCGGGATGCACTCTTACAACATGTGTGACTCTTGAACCTGGAGTTCATCACAT
TACGTCACAGCTTCCCATCTGGTTGCTTTCCTGAGTCAGCTACTTCACACTTGTCAAGGC
TGTTTTACCCCAAAACTCAGACAGGACTTTCTATGCATGTTTTCCCTCCTCCCCCCAATT
CCCCCCCCCATCACCTTATCTCCCAGGACACACTTGAGAAGTAGCTTTTTATTCCTAGTG
GTGTACATTTAATTTTAAAAAGGTTGCAATGTATCATGCTTGTTGCCGAAACTGTTTATG
GCCTTCTTGTTTCAGTTTTTTCTTTTCTTCCAATGGTACTTTAGCTGTTGAGTGCAGGTT
ACAACCTATATTGTTATGCAGATGGCTTCTTTAGGAATAACTTTTATATTTATTTAAAAA
TTTTTAAATTATGGGATGTTTTGTTGTTGTTGTTGTCTTTGTTGTTGGTCATTTGTCAAT
ATTCAGTCACCAATTCTGCTCACTTCTTGCCATGGATAAAATTGGGTCTTTCTGGCTAAT
TAAAAAAGACAACTTTATAAAATGGCACTTTAAGCAAGCCATAGTTAGTTTTATTTTTGT
AATGCACATGGCAAAGCAAAGACGTTTGTGATGAAGGAACTGCTCATCTAAGCAAAAGAT
TTGAGTATGATATGATAAAGGCTTTCTACATTCTAATTTACTTTTTCCCCCCACTTGAAT
GTGTTTTAAAGGCTAATTATCAGCTCAGTAGAGCAGTGAGAAACTGATCAAATTGCACTT
GTTCTCCTACAAGCAACCTCCACGCAGACACCTCGTACTGCTACAGGTGTGTCATTTCCT
TTAATAGGACCAGGGACCATGTAACTGAGGTGAGGGTTGTAGTAGATGCTTCCAGTGTCA
GTATGCCTGTTAATTTTAAGAGCTTCCCTTTCTTGCAGAGAACAAGTCTGCCCAGATTCC
ATGCTTTCTATAACTGGAGGACCTGGCAAACCTGCCGCATGCTGCACACATCTACCTACG
TACACATATACAATAGTATTGATGATTCTGAACAATAACAGGGTAAAACAGTTGGTTTGC
CATTGTTAAAAACTGATTTACAGTAACTTACAACAACTGTACTTTTGTTGGATTAGCAAA
TCATGTGTTTAAACAAATCCCATATGTTGGGCAACAGTTCAAATAAGCACGGAGAAGTGT
TGCCCAAACTTGGTTCTCTGACTCTTATGTATTTGTAAGGCTGGGCTTCAAAATCAAAAC
AAAAACCCCAAAAACAGCAGGCAAATGCTTTTTAACTCTGACACCGTTGCCATAAATCCC
TGATACTCAAAGTCTAACAAGAAAGACATGGAAAATTAGCAGCCCATTTTCAGAAAGATC
AAAATGATCTAGGGTTCTAATTGCTTTTGCATCCTATTCTTACAAAGTGATGTCCCAACA
GGGAACAGTAGGAGCTGGAGTGGGATCTCCAAGTCCCAGTTTGAGTGTGGGATGTGCTTC
CAGCAGTGCCTTCCCTTTATGAAAGACATCACATGGCATCCAGGGCCAGGCAGGCAGCTT
GAGGTGCCTTTACGAGAAAACCGAGCTGGGGCTGGGAGAGGACAGTTATTGACACTGATG
TGCAATGAAGTGACAAGATGAGAGCAGAATCGTAAGAGCTTTGAATTTGAAGTGAGTTTT
TTTCCCCCCATAAGTTATTTATTCCTTTTTTCTGTGTAAATATATTTATTTTACTGTGGA
GCGCTAACATCTGGATCGTAACATGTGCAGAATGTATGGTAGGAATGTATTCTCTTGTAG
GAATGTAAATCTGTATTAAAAGGGGGTCCAAGCCAGGCCCCCAGGTCTTCTCATTGTATG
CACAGTCCGCATTCATTTTTACTCTTCTCTAATATGGGTCTATTTGAAATATGCAAAAGG
TATGAGGAATGTTTTAATACCTCCAAATTTTTAAGAAAAGCATCAAAGGGTTGATATTTT
TTAAAGTTTTTTTAGTAGCACTTTCTCTGGATGACAGAAGGAGCAACCACATGGGCACCC
TTGTTCATACCAAAGGGTGAGCAGTGGCCAGAGCCTCCTCTGCACCTCTCGAGTGTCTTT
ACCAATTGAGCTTTTTATCGCCATAGCCCCTTGGAGTGCCCCAGCTGCCCTGAGGTCAAT
CAAGGAAAATTTCTTAATGAAATAAGCTCCAAAGAGCCAAAGTATCAACTTACAGATCGT
TTTTAAAGCTTAAATTTATGAACCACCTTTGTGGTAAACAATGAATTATGAATACCGCAG
GGCAGCCTTCTTAAATGACAAATGTAAAAAAAAAAAAAAAAAAGACTCTACTTCGTGCAG
CAATTGCTACTCTATACGAATTGTCTTAATTTGAAAACCTTGCTGTTACAAATTGGACCT
TTATACATTTTCTGAAAACAATGAAAAGAGTATATTTAACCTTTTCTGGCTGTAAATGGT
TACCTTCCTGTAACTGCCCCGCACCTGGAGGCATGGAGTTGTGTGCATCCTGCTTATGTA
CAATTGTTTTCAGTGTTTCTAAGAATGAGTCTGAATGGTTCTTGAAAATTAGCCAGGATC
AAATGCTATTGCAGACAAAGCCAATAAAAAGTTGGACTTCTTTTGGGGATAACAAGTTTT
GGAAGAGAAATGCAGGCCATATGTGCGCATGACCGAGATTTTGAAAAAAGATGTACATAG
TGACATGTTTGGTGCATGGTTTTTGAGGAGGGCTTTTGTCAAAAAGGAGGTATAACCTTT
CCCCCACAGACCTGAGAGCTGTGCCTTTTCTATGCAATATTACAGACGTTACATCGGAAC
CCAGATGGCTGTATTCACATGTAGGTTTGGGCTGTAATCTAAACAATTGGACAGATTAAA
TGTACATGGAAATGAGCAGTCTTACTTTTGTAGTTTTATATTATACAATAAACAGTTAAA
AGATGA

Protein Sequence

>9792 : length: 321
MLPVIQYMLGKGGKRKFDEHEDGLEGKIVSPCDGPSKVSYTLQRQTIFNISLMKLYNHRP
LTEPSLQKTVLINNMLRRIQEELKQEGSLRPMFTPSSQPTTEPSDSYREAPPAFSHLASP
SSHPCDLGSTTPLEACLTPASLLEDDDDTFCTSQAMQPTAPTKLSPPALLPEKDSFSSAL
DEIEELCPTSTSTEAATAATDSVKGTSSEAGTQKLDGPQESRADDSKLMDSLPGNFEITT
STGFLTDLTLDDILFADIDTSMYDFDPCTSSSGTASKMAPVSADDLLKTLAPYSSQPVTP
SQPFKMDLTELDHIMEVLVGS