ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

9733

Name

SART3

Synonym

DSAP1|P100|RP11-13G14|TIP110|p110|p110(nrb);squamous cell carcinoma antigen recognized by T cells 3;SART3;squamous cell carcinoma antigen recognized by T cells 3

Definition

SART-3|hSART-3|p110 nuclear RNA-binding protein|squamous cell carcinoma antigen recognized by T-cells 3|tat-interacting protein of 110 kDa

Position

12q24.1

Gene Type

protein-coding

External Links

Links to cell senescence gene database

9733

Links to epithelial mesenchymal transition gene database

9733

Links to ovarian cancer gene database

9733

Links to endometrial cancer gene database

9733

Links to iHOP

9733

Sequence Information

Nucleotide Sequence

>9733 : length: 4377
AGTTGTGACGGAACGCATGCCATTATAATGAGTTTTTATATCTGGTGGGAGCTTTTACAG
GGTATAAAATAATGTGAATTTAGTGTATGTGGAGATTTTCCTGTTATCTAAGTTCCCAGT
TTCTCTTTCAATGGCAAGAAAACGGGTTTTTGATAAGGCGCGCGCCGCGGGCAGCTTCTG
CCTCAGCGGGTCTTCGGCGGCCGCGGGAAGACCCGAGAGTCATTAGAAGCGCAAGATGGC
GACTGCGGCCGAAACCTCGGCTTCAGAACCCGAGGCTGAGTCCAAGGCTGGGCCCAAGGC
TGACGGAGAGGAGGATGAGGTTAAGGCGGCTAGGACAAGGAGGAAGGTGTTATCGCGGGC
TGTGGCCGCTGCGACATACAAGACCATGGGGCCAGCGTGGGATCAGCAGGAGGAAGGCGT
GAGCGAGAGCGATGGGGATGAGTACGCCATGGCTTCCTCCGCGGAGAGCTCCCCCGGGGA
GTACGAGTGGGAATATGACGAAGAGGAGGAGAAAAACCAGCTGGAGATTGAGAGACTGGA
GGAGCAGTTGTCTATCAACGTCTATGACTACAACTGCCATGTGGACTTGATCAGACTGCT
CAGGCTGGAAGGGGAGCTTACCAAGGTGAGGATGGCCCGCCAGAAGATGAGTGAAATCTT
TCCCTTGACTGAAGAGCTCTGGCTGGAGTGGCTGCATGACGAGATCAGCATGGCCCAGGA
TGGCCTGGACAGAGAGCACGTGTATGACCTCTTTGAGAAAGCCGTGAAGGATTACATTTG
TCCTAACATTTGGCTAGAGTATGGCCAGTACTCAGTTGGTGGGATTGGTCAGAAAGGTGG
CCTTGAGAAAGTTCGCTCCGTGTTTGAAAGGGCTCTCTCGTCTGTTGGTTTACATATGAC
CAAAGGACTCGCCCTCTGGGAGGCTTACCGAGAGTTTGAAAGTGCGATTGTGGAAGCTGC
TCGGCTTGAGAAAGTCCACAGTCTTTTCCGGCGACAGTTGGCGATCCCACTCTATGATAT
GGAGGCCACATTTGCAGAGTATGAAGAATGGTCAGAAGACCCAATACCAGAGTCAGTAAT
TCAGAACTATAACAAAGCACTACAGCAGCTGGAGAAATATAAACCCTATGAAGAAGCACT
GTTGCAGGCAGAGGCACCAAGGCTGGCAGAATATCAAGCATATATCGATTTTGAGATGAA
AATTGGCGATCCTGCTCGCATTCAGTTGATCTTTGAGCGCGCCCTGGTCGAGAACTGCCT
TGTCCCAGACTTATGGATCCGTTACAGTCAGTACCTAGATCGACAACTGAAAGTAAAGGA
TTTGGTTTTATCTGTACATAACCGCGCTATTAGAAACTGCCCCTGGACAGTTGCCTTATG
GAGTCGGTACCTCTTGGCCATGGAGAGACATGGAGTTGATCATCAAGTAATTTCTGTAAC
CTTCGAGAAAGCTTTGAATGCCGGCTTCATCCAGGCCACTGATTATGTGGAGATTTGGCA
GGCATACCTTGATTACCTGAGGAGAAGGGTTGATTTCAAACAAGACTCCAGTAAAGAGCT
GGAGGAGTTGAGGGCCGCCTTTACTCGTGCCTTGGAGTATCTGAAGCAGGAGGTGGAAGA
GCGTTTCAATGAGAGTGGTGATCCAAGCTGCGTGATTATGCAGAACTGGGCTAGGATTGA
GGCTCGACTGTGCAATAACATGCAGAAAGCTCGGGAACTCTGGGATAGCATCATGACCAG
AGGAAATGCCAAGTACGCCAACATGTGGCTAGAGTATTACAACCTGGAAAGAGCTCATGG
TGACACCCAGCACTGCCGGAAGGCTCTGCACCGGGCCGTCCAGTGCACCAGTGACTACCC
AGAGCACGTCTGCGAAGTGTTACTCACCATGGAGAGGACAGAAGGTTCTTTAGAAGATTG
GGATATAGCTGTTCAGAAAACTGAAACCCGATTAGCTCGTGTCAATGAGCAGAGAATGAA
GGCTGCAGAGAAGGAAGCAGCCCTTGTGCAGCAAGAAGAAGAAAAGGCTGAACAACGGAA
AAGAGCTCGGGCTGAGAAGAAAGCGTTAAAAAAGAAGAAAAAGATCAGAGGCCCAGAGAA
GCGCGGAGCAGATGAGGATGATGAGAAAGAGTGGGGCGATGATGAAGAAGAGCAGCCTTC
CAAACGCAGAAGGGTCGAGAACAGCATCCCTGCAGCTGGAGAAACACAAAATGTAGAAGT
AGCAGCAGGGCCCGCTGGGAAATGTGCTGCCGTAGATGTGGAGCCCCCTTCGAAGCAGAA
GGAGAAGGCAGCCTCCCTGAAGAGGGACATGCCCAAGGTGCTGCACGACAGCAGCAAGGA
CAGCATCACCGTCTTTGTCAGCAACCTGCCCTACAGCATGCAGGAGCCGGACACGAAGCT
CAGGCCACTCTTCGAGGCCTGTGGGGAGGTGGTCCAGATCCGACCCATCTTCAGCAACCG
TGGGGATTTCCGAGGTTACTGCTACGTGGAGTTTAAAGAAGAGAAATCAGCCCTTCAGGC
ACTGGAGATGGACCGGAAAAGTGTAGAAGGGAGGCCAATGTTTGTTTCCCCCTGTGTGGA
TAAGAGCAAAAACCCCGATTTTAAGGTGTTCAGGTACAGCACTTCCCTAGAGAAACACAA
GCTGTTCATCTCAGGCCTGCCTTTCTCCTGTACTAAAGAGGAACTAGAAGAAATCTGTAA
GGCTCATGGCACCGTGAAGGACCTCAGGCTGGTCACCAACCGGGCTGGCAAACCAAAGGG
CCTGGCCTACGTGGAGTATGAAAATGAATCCCAGGCGTCGCAGGCTGTGATGAAGATGGA
CGGCATGACTATCAAAGAGAACATCATCAAAGTGGCAATCAGCAACCCTCCTCAGAGGAA
AGTTCCAGAGAAGCCGGAGACCAGGAAGGCACCAGGTGGCCCCATGCTTTTGCCGCAGAC
ATACGGAGCGAGGGGGAAGGGAAGGACGCAGCTGTCTCTACTGCCTCGTGCCCTGCAGCG
CCCAAGTGCTGCAGCTCCTCAGGCTGAGAACGGCCCTGCCGCGGCTCCTGCAGTTGCCGC
CCCAGCAGCCACCGAGGCACCCAAGATGTCCAATGCCGATTTTGCCAAGCTGTTTCTGAG
AAAGTGAACGGGACGCTGGGAGACAGGAAATGCCTTACTTCACTCTGGCCCGGCGGACCT
CCCACCACCCAGCAGTGCACTGGGGATGGACAGGCCTGGTGTGCTGCGTGCTCGCAACCA
CAGATGGCTCCTCGGCTTTAGACAGAAAGGGGAAGGGGTTCTAAGTCAAGAGCCTTTCAG
TGCTCCCTCATATTGAGGGCAGTGGCAGAAAAGTGACCACTCTGCAGGCTGGGCCCAGGA
TGTGGTGTCCTGAGATAGTTTTGTATCTTAAAGACTGAGGCACAGAAGCGAAACGAGAAC
ACACTGTTTTTGAGACACAGTTGTCCAAATGTTTCTGGCCAGCTCCGGCCCCTTTTTGTA
TGACACTTCTCTTCCACCCTGCACAGCACATGTGCCCGTCATTCTTTTAATTTTAAAAGA
TGAAATGGCAGATGCTAGTAATTCACAGAATGGCCTCTTGTGGGGGTGGGTCTGAGGGAA
GTCAGCTATAAAACATTTGCTGGAGTTTTGTTCAATGGGGCTGTGCATTTTTATATTATG
TGTTTGTAAATGACATGTCAGCCATTGTTTCATGTTTCCTAAAAGCAGAATATTTGCAAC
ATTTGTTTTGTATAGGAATTATTTGTGCCACCTGCTGTGGACTGTTTTCTTTGCCTAGTG
ACTAGTGACCTGTGTTGTCTAAACATGAGTTTCAGCCCTTTGGTTTTGTTTAATACCATG
TCAAATGCAAACTTCAATTCTCCCCATTTAGCTTTATTAAACTGACGTTCTCTTCAAAAC
TTCTTGCTGAATGGTACTCAGATGTGCATTCACATACAGATGTGTTTTGAAGTGGGTGTA
CCTTGCTTTACCTAATAGATGTGTAAATAGAACTTTTGTAAGTCAAATCCCATTGTCACT
TTGATTTAAATTATTCCAGCTGTGATGTGTCTTCATTTTATAGCAGTTTGACACTGGAGC
TTTTGAGCTTTTTTACCTCACATCTTTTATCAAATAATATTTACTGCTTTGAAAACAGCA
ACAGCATTGGCCAGTTCAGTAGGGGAAGCTTGCTTTATTAAGACACTCTGGAGAAAGACG
TCAGGGAATCCTTGTATATGTCGTGGGAATCAACTCCTCATTTATCTGTTGCGTAAGTTT
AAGTTTTTGTGCATCAGTCGGGTTTTCTATATTTTTTTAACTTAACATTTTTTAATATAA
CCGATTAAAAAGTAGACAGAACAGTAAAATAAACTCCTGTGTGCCTACCAAAAAAAA

Protein Sequence

>9733 : length: 981
MATAAETSASEPEAESKAGPKADGEEDEVKAARTRRKVLSRAVAAATYKTMGPAWDQQEE
GVSESDGDEYAMASSAESSPGEYEWEYDEEEEKNQLEIERLEEQLSINVYDYNCHVDLIR
LLRLEGELTKVRMARQKMSEIFPLTEELWLEWLHDEISMAQDGLDREHVYDLFEKAVKDY
ICPNIWLEYGQYSVGGIGQKGGLEKVRSVFERALSSVGLHMTKGLALWEAYREFESAIVE
AARPVAGFLSPFDREQTFDSQLEKVHSLFRRQLAIPLYDMEATFAEYEEWSEDPIPESVI
QNYNKALQQLEKYKPYEEALLQAEAPRLAEYQAYIDFEMKIGDPARIQLIFERALVENCL
VPDLWIRYSQYLDRQLKVKDLVLSVHNRAIRNCPWTVALWSRYLLAMERHGVDHQVISVT
FEKALNAGFIQATDYVEIWQAYLDYLRRRVDFKQDSSKELEELRAAFTRALEYLKQEVEE
RFNESGDPSCVIMQNWARIEARLCNNMQKARELWDSIMTRGNAKYANMWLEYYNLERAHG
DTQHCRKALHRAVQCTSDYPEHVCEVLLTMERTEGSLEDWDIAVQKTETRLARVNEQRMK
AAEKEAALVQQEEEKAEQRKRARAEKKALKKKKKIRGPEKRGADEDDEKEWGDDEEEQPS
KRRRVENSIPAAGETQNVEVAAGPAGKCAAVDVEPPSKQKEKAASLKRDMPKVLHDSSKD
SITVFVSNLPYSMQEPDTKLRPLFEACGEVVQIRPIFSNRGDFRGYCYVEFKEEKSALQA
LEMDRKSVEGRPMFVSPCVDKSKNPDFKVFRYSTSLEKHKLFISGLPFSCTKEELEEICK
AHGTVKDLRLVTNRAGKPKGLAYVEYENESQASQAVMKMDGMTIKENIIKVAISNPPQRK
VPEKPETRKAPGGPMLLPQTYGARGKGRTQLSLLPRALQRPSAAAPQAENGPAAAPAVAA
PAATEAPKMSNADFAKLFLRK