ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

9700

Name

ESPL1

Synonym

ESP1|SEPA;extra spindle pole bodies homolog 1 (S. cerevisiae);ESPL1;extra spindle pole bodies homolog 1 (S. cerevisiae)

Definition

caspase-like protein ESPL1|extra spindle poles like 1|extra spindle poles-like 1 protein|separin|separin, cysteine protease

Position

12q

Gene Type

protein-coding

Pathways and Diseases

Pathway

Cell cycle;KEGG PATHWAY;hsa04110

Pathway

Oocyte meiosis;KEGG PATHWAY;hsa04114

Disease

Lung cancer;FunDO

External Links

Links to cell senescence gene database

9700

Links to epithelial mesenchymal transition gene database

9700

Links to ovarian cancer gene database

9700

Links to endometrial cancer gene database

9700

Links to iHOP

9700

Sequence Information

Nucleotide Sequence

>9700 : length: 6685
TATTTGAAAGGAGGGTCTGGCGCGGAAAACGAAGGTTACATTTTGGATCCTCGCGGAGTA
CTGGTCAGGCGGTTAAGTCCTGTACCTAGGAAAGAGGGCGAGCTCTGGGGCGGTAAGGCC
GGAAGGGACTCGTGAGCGTGGCTCTCCGGTGTCATGAGGAGCTTCAAAAGAGTCAACTTT
GGGACTCTGCTAAGCAGCCAGAAGGAGGCTGAAGAGTTGCTGCCCGCCTTGAAGGAGTTC
CTGTCCAACCCTCCAGCTGGTTTTCCCAGCAGCCGATCTGATGCTGAGAGGAGACAAGCT
TGTGATGCCATCCTGAGGGCTTGCAACCAGCAGCTGACTGCTAAGCTAGCTTGCCCTAGG
CATCTGGGGAGCCTGCTGGAGCTGGCAGAGCTGGCCTGTGATGGCTACTTAGTGTCTACC
CCACAGCGTCCTCCCCTCTACCTGGAACGAATTCTCTTTGTCTTACTGCGGAATGCTGCT
GCACAAGGAAGCCCAGAGGCCACACTCCGCCTTGCTCAGCCCCTCCATGCCTGCTTGGTG
CAGTGCTCTCGCGAGGCTGCTCCCCAGGACTATGAGGCCGTGGCTCGGGGCAGCTTTTCT
CTGCTTTGGAAGGGGGCAGAAGCCCTGTTGGAACGGCGAGCTGCATTTGCAGCTCGGCTG
AAGGCCTTGAGCTTCCTAGTACTCTTGGAGGATGAAAGTACCCCTTGTGAGGTTCCTCAC
TTTGCTTCTCCAACAGCCTGTCGAGCGGTAGCTGCCCATCAGCTATTTGATGCCAGTGGC
CATGGTCTAAATGAAGCAGATGCTGATTTCCTAGATGACCTGCTCTCCAGGCACGTGATC
AGAGCCTTGGTGGGTGAGAGAGGGAGCTCTTCTGGGCTTCTTTCTCCCCAGAGGGCCCTC
TGCCTCTTGGAGCTCACCTTGGAACACTGCCGTCGCTTTTGCTGGAGCCGCCACCATGAC
AAAGCCATCAGCGCAGTGGAGAAGGCTCACAGTTACCTAAGGAACACCAATCTAGCCCCT
AGCCTTCAGCTATGTCAGCTGGGGGTTAAGCTGCTGCAGGTTGGGGAGGAAGGACCTCAG
GCAGTGGCCAAGCTTCTGATCAAGGCATCAGCTGTCCTGAGCAAGAGTATGGAGGCACCA
TCACCCCCACTTCGGGCATTGTATGAGAGCTGCCAGTTCTTCCTTTCAGGCCTGGAACGA
GGCACCAAGAGGCGCTATAGACTTGATGCCATTCTGAGCCTCTTTGCTTTTCTTGGAGGG
TACTGCTCTCTTCTGCAGCAGCTGCGGGATGATGGTGTGTATGGGGGCTCCTCCAAGCAA
CAGCAGTCTTTTCTTCAGATGTACTTTCAGGGACTTCACCTCTACACTGTGGTGGTTTAT
GACTTTGCCCAAGGCTGTCAGATAGTTGATTTGGCTGACCTGACCCAACTAGTGGACAGT
TGTAAATCTACCGTTGTCTGGATGCTGGAGGCCTTAGAGGGCCTGTCGGGCCAAGAGCTG
ACGGACCACATGGGGATGACCGCTTCTTACACCAGTAATTTGGCCTACAGCTTCTATAGT
CACAAGCTCTATGCCGAGGCCTGTGCCATCTCTGAGCCGCTCTGTCAGCACCTGGGTTTG
GTGAAGCCAGGCACTTATCCCGAGGTGCCTCCTGAGAAGTTGCACAGGTGCTTCCGGCTA
CAAGTAGAGAGTTTGAAGAAACTGGGTAAACAGGCCCAGGGCTGCAAGATGGTGATTTTG
TGGCTGGCAGCCCTGCAACCCTGTAGCCCTGAACACATGGCTGAGCCAGTCACTTTCTGG
GTTCGGGTCAAGATGGATGCGGCCAGGGCTGGAGACAAGGAGCTACAGCTAAAGACTCTG
CGAGACAGCCTCAGTGGCTGGGACCCGGAGACCCTGGCCCTCCTGCTGAGGGAGGAGCTG
CAGGCCTACAAGGCGGTGCGGGCCGACACTGGACAGGAACGCTTCAACATCATCTGTGAC
CTCCTGGAGCTGAGCCCCGAGGAGACACCAGCCGGGGCCTGGGCACGAGCCACCCACCTG
GTAGAACTGGCTCAGGTGCTCTGCTACCACGACTTTACGCAGCAGACCAACTGCTCTGCT
CTGGATGCTATCCGGGAAGCCCTGCAGCTTCTGGACTCTGTGAGGCCTGAGGCCCAGGCC
AGAGATCAGCTTCTGGACGATAAAGCACAGGCCTTGCTGTGGCTTTACATCTGTACTCTG
GAAGCCAAAATGCAGGAAGGTATCGAGCGGGATCGGAGAGCCCAGGCCCCTGGTAACTTG
GAGGAATTTGAAGTCAATGACCTGAACTATGAAGATAAACTCCAGGAAGATCGTTTCCTA
TACAGTAACATTGCCTTCAACCTGGCTGCAGATGCTGCTCAGTCCAAATGCCTGGACCAA
GCCCTGGCCCTGTGGAAGGAGCTGCTTACAAAGGGGCAGGCCCCAGCTGTACGGTGTCTC
CAGCAGACAGCAGCCTCACTGCAGATCCTAGCAGCCCTCTACCAGCTGGTGGCAAAGCCC
ATGCAGGCTCTGGAGGTCCTCCTGCTGCTACGGATTGTCTCTGAGAGACTGAAGGACCAC
TCGAAGGCAGCTGGCTCCTCCTGCCACATCACCCAGCTCCTCCTGACCCTCGGCTGTCCC
AGCTATGCCCAGTTACACCTGGAAGAGGCAGCATCGAGCCTGAAGCATCTCGATCAGACT
ACTGACACATACCTGCTCCTTTCCCTGACCTGTGATCTGCTTCGAAGTCAACTCTACTGG
ACTCACCAGAAGGTGACCAAGGGTGTCTCTCTGCTGCTGTCTGTGCTTCGGGATCCTGCC
CTCCAGAAGTCCTCCAAGGCTTGGTACTTGCTGCGTGTCCAGGTCCTGCAGCTGGTGGCA
GCTTACCTTAGCCTCCCGTCAAACAACCTCTCACACTCCCTGTGGGAGCAGCTCTGTGCC
CAAGGCTGGCAGACACCTGAGATAGCTCTCATAGACTCCCATAAGCTCCTCCGAAGCATC
ATCCTCCTGCTGATGGGCAGTGACATTCTCTCAACTCAGAAAGCAGCTGTGGAGACATCG
TTTTTGGACTATGGTGAAAATCTGGTACAAAAATGGCAGGTTCTTTCAGAGGTGCTGAGC
TGCTCAGAGAAGCTGGTCTGCCACCTGGGCCGCCTGGGTAGTGTGAGTGAAGCCAAGGCC
TTTTGCTTGGAGGCCCTAAAACTTACAACAAAGCTGCAGATACCACGCCAGTGTGCCCTG
TTCCTGGTGCTGAAGGGCGAGCTGGAGCTGGCCCGCAATGACATTGATCTCTGTCAGTCG
GACCTGCAGCAGGTTCTGTTCTTGCTTGAGTCTTGCACAGAGTTTGGTGGGGTGACTCAG
CACCTGGACTCTGTGAAGAAGGTCCACCTGCAGAAGGGGAAGCAGCAGGCCCAGGTCCCC
TGTCCTCCACAGCTCCCAGAGGAGGAGCTCTTCCTAAGAGGCCCTGCTCTAGAGCTGGTG
GCCACTGTGGCCAAGGAGCCTGGCCCCATAGCACCTTCTACAAACTCCTCCCCAGTCTTG
AAAACCAAGCCCCAGCCCATACCCAACTTCCTGTCCCATTCACCCACCTGTGACTGCTCG
CTCTGCGCCAGCCCTGTCCTCACAGCAGTCTGTCTGCGCTGGGTATTGGTCACGGCAGGG
GTGAGGCTGGCCATGGGCCACCAAGCCCAGGGTCTGGATCTGCTGCAGGTCGTGCTGAAG
GGCTGTCCTGAAGCCGCTGAGCGCCTCACCCAAGCTCTCCAAGCTTCCCTGAATCATAAA
ACACCCCCCTCCTTGGTTCCAAGCCTCTTGGATGAGATCTTGGCTCAAGCATACACACTG
TTGGCACTGGAGGGCCTGAACCAGCCATCAAACGAGAGCCTGCAGAAGGTTCTACAGTCA
GGGCTGAAGTTTGTAGCAGCACGGATACCCCACCTAGAGCCCTGGCGAGCCAGCCTGCTC
TTGATTTGGGCCCTCACAAAACTAGGTGGCCTCAGCTGCTGTACTACCCAACTTTTTGCA
AGCTCCTGGGGCTGGCAGCCACCATTAATAAAAAGTGTCCCTGGCTCAGAGCCCTCTAAG
ACTCAGGGCCAAAAACGTTCTGGACGAGGGCGCCAAAAGTTAGCCTCTGCTCCCCTGCGC
CTCAATAATACCTCTCAGAAAGGTCTGGAAGGTAGAGGACTGCCCTGCACACCTAAACCC
CCAGACCGGATCAGGCAAGCTGGCCCTCATGTCCCCTTCACGGTGTTTGAGGAAGTCTGC
CCTACAGAGAGCAAGCCTGAAGTACCCCAGGCCCCCAGGGTACAACAGAGAGTCCAGACG
CGCCTCAAGGTGAACTTCAGTGATGACAGTGACTTGGAAGACCCTGTCTCAGCTGAGGCC
TGGCTGGCAGAGGAGCCTAAGAGACGGGGCACTGCTTCCCGGGGCCGGGGGCGAGCAAGG
AAGGGCCTGAGCCTAAAGACGGATGCCGTGGTTGCCCCAGGTAGTGCCCCTGGGAACCCT
GGCCTGAATGGCAGGAGCCGGAGGGCCAAGAAGGTGGCATCAAGACATTGTGAGGAGCGG
CGTCCCCAGAGGGCCAGTGACCAGGCCAGGCCTGGCCCTGAGATCATGAGGACCATCCCT
GAGGAAGAACTGACTGACAACTGGAGAAAAATGAGCTTTGAGATCCTCAGGGGCTCTGAC
GGGGAAGACTCAGCCTCAGGTGGGAAGACTCCAGCTCCGGGCCCTGAGGCAGCTTCTGGA
GAATGGGAGCTGCTGAGGCTGGATTCCAGCAAGAAGAAGCTGCCCAGCCCATGCCCAGAC
AAGGAGAGTGACAAGGACCTTGGTCCTCGGCTCCGGCTCCCCTCAGCCCCCGTAGCCACT
GGTCTTTCTACCCTGGACTCCATCTGTGACTCCCTGAGTGTTGCTTTCCGGGGCATTAGT
CACTGTCCTCCTAGTGGGCTCTATGCCCACCTCTGCCGCTTCCTGGCCTTGTGCCTGGGC
CACCGGGATCCTTATGCCACTGCTTTCCTTGTCACCGAGTCTGTCTCCATCACCTGTCGC
CACCAGCTGCTCACCCACCTCCACAGACAGCTCAGCAAGGCCCAGAAGCACCGAGGATCA
CTTGAAATAGCAGACCAGCTGCAGGGGCTGAGCCTTCAGGAGATGCCTGGAGATGTCCCC
CTGGCCCGCATCCAGCGCCTCTTTTCCTTCAGGGCTTTGGAATCTGGCCACTTCCCCCAG
CCTGAAAAGGAGAGTTTCCAGGAGCGCCTGGCTCTGATCCCCAGTGGGGTGACTGTGTGT
GTGTTGGCCCTGGCCACCCTCCAGCCCGGAACCGTGGGCAACACCCTCCTGCTGACCCGG
CTGGAAAAGGACAGTCCCCCAGTCAGTGTGCAGATTCCCACTGGCCAGAACAAGCTTCAT
CTGCGTTCAGTCCTGAATGAGTTTGATGCCATCCAGAAGGCACAGAAAGAGAACAGCAGC
TGTACTGACAAGCGAGAATGGTGGACAGGGCGGCTGGCACTGGACCACAGGATGGAGGTT
CTCATCGCTTCCCTAGAGAAGTCTGTGCTGGGCTGCTGGAAGGGGCTGCTGCTGCCGTCC
AGTGAGGAGCCCGGCCCTGCCCAGGAGGCCTCCCGCCTACAGGAGCTGCTACAGGACTGT
GGCTGGAAATATCCTGACCGCACTCTGCTGAAAATCATGCTCAGTGGTGCCGGTGCCCTC
ACCCCTCAGGACATTCAGGCCCTGGCCTACGGGCTGTGCCCAACCCAGCCAGAGCGAGCC
CAGGAGCTCCTGAATGAGGCAGTAGGACGTCTACAGGGCCTGACAGTACCAAGCAATAGC
CACCTTGTCTTGGTCCTAGACAAGGACTTGCAGAAGCTGCCGTGGGAAAGCATGCCCAGC
CTCCAAGCACTGCCTGTCACCCGGCTGCCCTCCTTCCGCTTCCTACTCAGCTACTCCATC
ATCAAAGAGTATGGGGCCTCGCCAGTGCTGAGTCAAGGGGTGGATCCACGAAGTACCTTC
TATGTCCTGAACCCTCACAATAACCTGTCAAGCACAGAGGAGCAATTTCGAGCCAATTTC
AGCAGTGAAGCTGGCTGGAGAGGAGTGGTTGGGGAGGTGCCAAGACCTGAACAGGTGCAG
GAAGCCCTGACAAAGCATGATTTGTATATCTATGCAGGGCATGGGGCTGGTGCCCGCTTC
CTTGATGGGCAGGCTGTCCTGCGGCTGAGCTGTCGGGCAGTGGCCCTGCTGTTTGGCTGT
AGCAGTGCGGCCCTGGCTGTGCGTGGAAACCTGGAGGGGGCTGGCATCGTGCTCAAGTAC
ATCATGGCTGGTTGCCCCTTGTTTCTGGGTAATCTCTGGGATGTGACTGACCGCGACATT
GACCGCTACACGGAAGCTCTGCTGCAAGGCTGGCTTGGAGCAGGCCCAGGGGCCCCCCTT
CTCTACTATGTAAACCAGGCCCGCCAAGCTCCCCGACTCAAGTATCTTATTGGGGCTGCA
CCTATAGCCTATGGCTTGCCTGTCTCTCTGCGGTAACCCCATGGAGCTGTCTTATTGATG
CTAGAAGCCTCATAACTGTTCTACCTCCAAGGTTAGATTTAATCCTTAGGATAACTCTTT
TAAAGTGATTTTCCCCAGTGTTTTATATGAAACATTTCCTTTTGATTTAACCTCAGTATA
ATAAAGATACATCATTTAAACCCTG

Protein Sequence

>9700 : length: 2120
MRSFKRVNFGTLLSSQKEAEELLPALKEFLSNPPAGFPSSRSDAERRQACDAILRACNQQ
LTAKLACPRHLGSLLELAELACDGYLVSTPQRPPLYLERILFVLLRNAAAQGSPEATLRL
AQPLHACLVQCSREAAPQDYEAVARGSFSLLWKGAEALLERRAAFAARLKALSFLVLLED
ESTPCEVPHFASPTACRAVAAHQLFDASGHGLNEADADFLDDLLSRHVIRALVGERGSSS
GLLSPQRALCLLELTLEHCRRFCWSRHHDKAISAVEKAHSYLRNTNLAPSLQLCQLGVKL
LQVGEEGPQAVAKLLIKASAVLSKSMEAPSPPLRALYESCQFFLSGLERGTKRRYRLDAI
LSLFAFLGGYCSLLQQLRDDGVYGGSSKQQQSFLQMYFQGLHLYTVVVYDFAQGCQIVDL
ADLTQLVDSCKSTVVWMLEALEGLSGQELTDHMGMTASYTSNLAYSFYSHKLYAEACAIS
EPLCQHLGLVKPGTYPEVPPEKLHRCFRLQVESLKKLGKQAQGCKMVILWLAALQPCSPE
HMAEPVTFWVRVKMDAARAGDKELQLKTLRDSLSGWDPETLALLLREELQAYKAVRADTG
QERFNIICDLLELSPEETPAGAWARATHLVELAQVLCYHDFTQQTNCSALDAIREALQLL
DSVRPEAQARDQLLDDKAQALLWLYICTLEAKMQEGIERDRRAQAPGNLEEFEVNDLNYE
DKLQEDRFLYSNIAFNLAADAAQSKCLDQALALWKELLTKGQAPAVRCLQQTAASLQILA
ALYQLVAKPMQALEVLLLLRIVSERLKDHSKAAGSSCHITQLLLTLGCPSYAQLHLEEAA
SSLKHLDQTTDTYLLLSLTCDLLRSQLYWTHQKVTKGVSLLLSVLRDPALQKSSKAWYLL
RVQVLQLVAAYLSLPSNNLSHSLWEQLCAQGWQTPEIALIDSHKLLRSIILLLMGSDILS
TQKAAVETSFLDYGENLVQKWQVLSEVLSCSEKLVCHLGRLGSVSEAKAFCLEALKLTTK
LQIPRQCALFLVLKGELELARNDIDLCQSDLQQVLFLLESCTEFGGVTQHLDSVKKVHLQ
KGKQQAQVPCPPQLPEEELFLRGPALELVATVAKEPGPIAPSTNSSPVLKTKPQPIPNFL
SHSPTCDCSLCASPVLTAVCLRWVLVTAGVRLAMGHQAQGLDLLQVVLKGCPEAAERLTQ
ALQASLNHKTPPSLVPSLLDEILAQAYTLLALEGLNQPSNESLQKVLQSGLKFVAARIPH
LEPWRASLLLIWALTKLGGLSCCTTQLFASSWGWQPPLIKSVPGSEPSKTQGQKRSGRGR
QKLASAPLRLNNTSQKGLEGRGLPCTPKPPDRIRQAGPHVPFTVFEEVCPTESKPEVPQA
PRVQQRVQTRLKVNFSDDSDLEDPVSAEAWLAEEPKRRGTASRGRGRARKGLSLKTDAVV
APGSAPGNPGLNGRSRRAKKVASRHCEERRPQRASDQARPGPEIMRTIPEEELTDNWRKM
SFEILRGSDGEDSASGGKTPAPGPEAASGEWELLRLDSSKKKLPSPCPDKESDKDLGPRL
RLPSAPVATGLSTLDSICDSLSVAFRGISHCPPSGLYAHLCRFLALCLGHRDPYATAFLV
TESVSITCRHQLLTHLHRQLSKAQKHRGSLEIADQLQGLSLQEMPGDVPLARIQRLFSFR
ALESGHFPQPEKESFQERLALIPSGVTVCVLALATLQPGTVGNTLLLTRLEKDSPPVSVQ
IPTGQNKLHLRSVLNEFDAIQKAQKENSSCTDKREWWTGRLALDHRMEVLIASLEKSVLG
CWKGLLLPSSEEPGPAQEASRLQELLQDCGWKYPDRTLLKIMLSGAGALTPQDIQALAYG
LCPTQPERAQELLNEAVGRLQGLTVPSNSHLVLVLDKDLQKLPWESMPSLQALPVTRLPS
FRFLLSYSIIKEYGASPVLSQGVDPRSTFYVLNPHNNLSSTEEQFRANFSSEAGWRGVVG
EVPRPEQVQEALTKHDLYIYAGHGAGARFLDGQAVLRLSCRAVALLFGCSSAALAVRGNL
EGAGIVLKYIMAGCPLFLGNLWDVTDRDIDRYTEALLQGWLGAGPGAPLLYYVNQARQAP
RLKYLIGAAPIAYGLPVSLR