ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

9690

Name

UBE3C

Synonym

HECTH2;ubiquitin protein ligase E3C;UBE3C;ubiquitin protein ligase E3C

Definition

ubiquitin-protein isopeptide ligase (E3)|ubiquitin-protein ligase E3C

Position

7q36.3

Gene Type

protein-coding

Pathways and Diseases

Pathway

Ubiquitin proteasome pathway;PANTHER;P00060

Pathway

Ubiquitin mediated proteolysis;KEGG PATHWAY;hsa04120

Disease

quantitative traits;GAD

Disease

PHARMACOGENOMIC;GAD

Disease

Response to citalopram treatment;NHGRI

Disease

response to citalopram treatment;GAD

Disease

Quantitative traits;NHGRI

External Links

Links to cell senescence gene database

9690

Links to epithelial mesenchymal transition gene database

9690

Links to ovarian cancer gene database

9690

Links to endometrial cancer gene database

9690

Links to iHOP

9690

Sequence Information

Nucleotide Sequence

>9690 : length: 5195
GAGGCGGCAGTTCCAGGTGCAAGCGCCGGGTTTGCTGCCCGCTGGGCGCCCCTGCAGCGG
CCCGAGCTGTGGCCGGCGTGGATGAGGGGCAGGCGAGGCAGGGCCGCCCCTCCAGTATTG
CCGCCCCTCCCGCCCCAGGGCAGGGCTGGGAGGGTACAGCCCGGGGGCGGGCTCGGGTCG
CCTCCCGGCCGCCGCGTCCTCGCTGCCCCGGGCCGGGCGGGCGGGCGCCGAGAGCCTCCC
AGCCCGCCCCGTGCCCCGCCCGCCCGGCTGCTTCCGCGGCGGCGCTGCCCGCACATGGGC
TAGGCTGCCAGGATGTTCAGCTTCGAAGGCGACTTCAAGACGCGGCCCAAGGTGTCCCTT
GGCGGCGCGAGCAGGAAGGAGGAAAAGGCTTCTCTTTTACATCGTACTCAGGAAGAAAGA
AGAAAGAGAGAGGAAGAAAGGCGAAGGTTGAAAAATGCAATAATTATCCAGTCATTTATT
CGAGGCTATAGAGACAGAAAACAGCAATATTCCATCCAAAGAAGTGCATTTGATCGCTGT
GCTACCTTGTCACAGTCCGGGGGCGCTTTTCCCATTGCTAATGGCCCCAACCTTACCCTT
TTGGTAAGGCAGCTTCTGTTTTTTTACAAACAAAATGAAGACTCAAAACGTTTGATATGG
CTGTATCAGAACTTAATTAAACACAGCTCTCTGTTTGTCAAGCAGTTGGATGGATCTGAG
AGACTTACATGCTTATTTCAGATAAAAAGATTGATGAGCCTCTGTTGCAGGTTGCTGCAA
AACTGTAATGATGACAGTTTGAATGTTGCACTTCCAATGAGAATGCTTGAAGTATTTTCG
TCTGAGAATACTTACTTGCCTGTTTTACAAGATGCTAGCTATGTGGTGTCAGTGATTGAA
CAAATTTTGCACTACATGATTCACAATGGGTATTATAGGTCTCTATATTTGTTGATTAAC
AGCAAGCTTCCATCAAGTATTGAATATTCTGATTTATCTCGAGTTCCTATAGCAAAAATT
TTGCTAGAGAATGTTCTAAAACCATTGCACTTTACTTACAACTCCTGTCCGGAAGGTGCG
AGGCAACAAGTTTTTACAGCCTTCACAGAGGAGTTTCTGGCAGCACCTTTTACAGATCAG
ATTTTTCATTTCATCATTCCGGCGCTTGCAGATGCGCAGACCGTTTTCCCTTACGAGCCC
TTTCTGAATGCACTGTTGTTAATAGAGAGTAGATGTTCAAGAAAGAGTGGTGGAGCACCC
TGGCTTTTCTATTTCGTTTTAACTGTTGGCGAAAATTATTTGGGGGCCCTCTCTGAGGAA
GGGCTGCTGGTGTATTTGCGGGTGCTGCAGACCTTCCTCTCTCAGTTACCAGTCTCTCCT
GCCAGCGCGAGCTGTCACGACTCAGCCAGTGACTCTGAGGAGGAGAGTGAAGAAGCCGAC
AAGCCCTCAAGCCCGGAGGATGGCAGACTGTCAGTATCATACATAACAGAGGAATGCCTG
AAGAAGCTGGACACAAAGCAGCAGACCAACACCCTGCTCAACCTGGTGTGGAGGGACTCT
GCGAGCGAGGAGGTCTTCACCACCATGGCCTCCGTCTGCCACACGCTGATGGTGCAGCAC
CGCATGATGGTACCCAAAGTCAGGCTTCTCTACAGTTTAGCCTTTAATGCCAGGTTTCTG
AGACATCTTTGGTTTCTAATATCTTCCATGTCAACACGGATGATCACAGGGTCTATGGTA
CCGTTGCTTCAGGTGATATCCAGGGGTTCTCCTATGTCTTTTGAAGATTCTAGTCGAATC
ATCCCACTCTTTTATCTTTTTAGCTCCTTGTTTAGTCATTCACTAATTTCCATACATGAT
AACGAATTCTTCGGTGATCCCATAGAAGTTGTAGGTCAAAGACAATCATCAATGATGCCT
TTTACTTTAGAAGAGCTGATAATGTTGTCTCGATGCCTTCGAGATGCATGCCTGGGGATC
ATCAAGTTGGCTTATCCAGAAACCAAGCCAGAAGTTCGAGAAGAATATATTACAGCATTT
CAGAGTATTGGAGTTACTACTAGCTCTGAAATGCAACAATGCATACAGATGGAACAGAAA
AGATGGATTCAGTTATTTAAGGTTATCACCAATCTAGTGAAAATGTTGAAGTCCAGAGAC
ACGAGGAGAAATTTTTGTCCTCCAAACCACTGGCTGTCAGAACAAGAAGATATTAAAGCA
GATAAGGTCACTCAGCTCTATGTGCCAGCATCCAGACATGTGTGGAGGTTCCGGCGGATG
GGGAGGATAGGCCCGCTGCAGTCCACCCTGGACGTGGGTTTGGAGTCCCCGCCGCTGTCT
GTGTCTGAGGAAAGACAGCTTGCTGTCCTGACAGAGTTGCCTTTTGTGGTTCCATTTGAG
GAACGAGTAAAGATCTTTCAGAGGTTGATTTATGCAGATAAGCAAGAAGTTCAAGGAGAT
GGTCCATTTCTGGATGGAATTAATGTCACAATAAGAAGAAATTACATTTATGAAGATGCT
TATGACAAACTTTCTCCAGAAAATGAGCCTGATTTGAAAAAGCGGATCCGTGTGCACTTG
CTCAATGCCCATGGCCTGGATGAAGCTGGCATTGATGGTGGTGGTATTTTCAGAGAGTTT
TTAAATGAACTACTGAAGTCAGGATTTAACCCCAACCAGGGGTTCTTTAAGACTACTAAT
GAAGGGCTTCTGTACCCCAACCCGGCTGCTCAGATGCTTGTGGGAGATTCTTTTGCCAGA
CATTACTACTTCCTAGGCAGAATGCTTGGAAAGGCTCTCTATGAGAACATGCTGGTGGAG
CTGCCCTTTGCAGGCTTCTTTCTTTCCAAGTTGCTTGGAACCAGTGCCGACGTGGACATT
CACCACCTCGCCTCCCTAGACCCTGAGGTGTATAAGAATTTGCTCTTTCTGAAGAGCTAC
GAAGACGATGTGGAGGAGCTTGGGCTGAACTTCACTGTGGTGAACAATGACCTGGGAGAG
GCGCAGGTAGTTGAACTAAAATTCGGTGGGAAAGACATCCCTGTCACCAGCGCCAACCGG
ATTGCGTACATCCACTTGGTGGCAGACTACAGGCTGAACAGGCAGATCCGCCAGCACTGC
CTGGCTTTCCGCCAGGGCCTTGCCAATGTCGTCAGCCTCGAGTGGCTCCGAATGTTTGAT
CAGCAAGAAATTCAGGTATTAATTTCTGGTGCACAAGTTCCCATAAGCCTAGAGGACCTA
AAATCCTTTACAAACTATTCAGGAGGCTATTCTGCAGACCATCCTGTTATTAAGGTCTTC
TGGAGAGTTGTGGAAGGGTTCACTGATGAAGAAAAGCGCAAACTGCTGAAGTTTGTAACA
AGCTGCTCTCGACCCCCTCTCTTGGGGTTTAAGGAGTTGTATCCCGCATTTTGTATTCAC
AACGGAGGCTCCGACCTTGAGCGGCTCCCCACAGCCAGCACCTGCATGAACCTGCTGAAG
CTCCCCGAGTTCTATGACGAGACACTTTTGCGAAGTAAACTTCTCTATGCGATTGAATGT
GCCGCTGGCTTTGAGCTGAGCTGAAGCTGATGCTGGGGTCAGACCCCTACAGAGAACCAG
TGCTTCCTTCGTCAGCAGCGCCTCCCCAGACCCACGAGGATACTCACACTGCACGCCTGA
GGCTCTCCTAAGCTCCTTCTTTCATTCTGCCATTCCTCCCTCCCTTCCTTTTTTAAATGA
TTTTTATTACGGTGTGGTCACTTATTTAGATGGACATTGCTTTTCAAATAACTTAAAATA
ACACGTTATGTGCCATGTGGCTACTTTAGTAATATTGCCAAGAAGAGCACAGTTTTTACA
CTAGTGGCATCTCAGTGAAATTAACCAAAGATGAAGCTTTGGCTTTGCTGGTGAGATCAG
AGCCCTCCTGAGCAGGCAGCGCCACTCCAGGGTTCAGACAGGGCTGCACAGGCGGCAGAG
ATACAGGGTCTGAGGGCTGAGACGCCATGGGGCCGCTGCTGCTTATGTGGTTGGATTGTT
TACAAGCCTCATTATTAAAACTGAAGGCATTTTTTTTTTCTGCTGCCTTTCCCAAAGTGG
TTAGGTTTGGAAAAGAGATGATGATGGTAATATTTTATTTGTGCTTTTTAAGCCATTTCC
CCAAATGGGACTAGCATGCTTGTTTTCAGTATACCGTGGCCTGCCTCATGATGGTTTGGA
GATACTGTCTGTGGATGTGAGGTGGGGACTTCATTCATTGTCCTATTTCTATCTCCACTT
TGTGCCTGGAGAGCTTTCAGGGGAGGTGGAGGAGGAGGGTCTGCCAAGCTACTGCAACAT
CTGTCACCCACTATACCCAGTTACTTGGGGGAGGACAGACACTGTGGTGTCATTAAAGTT
GTTTGAACCAAAGTGGCGGCTGCATCTTTGTCCCGATGCTAGCCGTGCCGGTCTCCCATC
ATCCGCTCGCCCTCCTTTCCCCTGGGCTGCGCCCACTTGTCTTCCTGGATATTTGGGGGT
GACTCGCCATGCTTGGCACCCTCTGCTTCCTGGTGCTGCTCTGACTCGAAGACGGGACAG
TCCCTGGTGCACATCCAGGGAAGAGGAGTGTCGGTAGTTCTTGCAGTAGGCACTTTATCA
GGACCTGACCTGTTGCTGGGTGATTTTAGTCTCTACAAACAGAAAGCGTTTCAAAGCGTC
AGCTGTGGGAGCAGAGTGACCCTTTGCTGATGCTGGGGGGAGGGGATCTAAATCCTCATT
TATCTCTTCTATGTCTCGTATTTTACTGTCACTGGAGGCTCTGTGGGCTGTCATAGTTAA
TTGACCATAATTAGCAATATACTTTTAAAGTGGGAAAGCTGAATGACACTTTTAAGACAA
TGAACATTATCAAAACAAAATGTATAATTTCTTAATTTGAATAATAAATTAAGCGTTTAA
ATGCTATTTGTAGTCTTGATATACAGAAATAAAATAATTAGGGTTGGTCTTTTTTATTTT
AGGTTGTTTTATGTTGAATGTTCTATATCTTATTAGTTAATTTGTATATTTTATTAGTAT
TTTGGAAATAGCATATCTGAGACTGAAGAGAAATTGACAATTCACTTATTTGTGGTTTTT
TTCTCAGCTATTCTGAGCTTATTTATTTATTTGTATGTTCTAATGGCTAAACATTTACAT
TAAATGTTTTTTTTCCCAAGAAAAAAAAAAAAAAA

Protein Sequence

>9690 : length: 1083
MFSFEGDFKTRPKVSLGGASRKEEKASLLHRTQEERRKREEERRRLKNAIIIQSFIRGYR
DRKQQYSIQRSAFDRCATLSQSGGAFPIANGPNLTLLVRQLLFFYKQNEDSKRLIWLYQN
LIKHSSLFVKQLDGSERLTCLFQIKRLMSLCCRLLQNCNDDSLNVALPMRMLEVFSSENT
YLPVLQDASYVVSVIEQILHYMIHNGYYRSLYLLINSKLPSSIEYSDLSRVPIAKILLEN
VLKPLHFTYNSCPEGARQQVFTAFTEEFLAAPFTDQIFHFIIPALADAQTVFPYEPFLNA
LLLIESRCSRKSGGAPWLFYFVLTVGENYLGALSEEGLLVYLRVLQTFLSQLPVSPASAS
CHDSASDSEEESEEADKPSSPEDGRLSVSYITEECLKKLDTKQQTNTLLNLVWRDSASEE
VFTTMASVCHTLMVQHRMMVPKVRLLYSLAFNARFLRHLWFLISSMSTRMITGSMVPLLQ
VISRGSPMSFEDSSRIIPLFYLFSSLFSHSLISIHDNEFFGDPIEVVGQRQSSMMPFTLE
ELIMLSRCLRDACLGIIKLAYPETKPEVREEYITAFQSIGVTTSSEMQQCIQMEQKRWIQ
LFKVITNLVKMLKSRDTRRNFCPPNHWLSEQEDIKADKVTQLYVPASRHVWRFRRMGRIG
PLQSTLDVGLESPPLSVSEERQLAVLTELPFVVPFEERVKIFQRLIYADKQEVQGDGPFL
DGINVTIRRNYIYEDAYDKLSPENEPDLKKRIRVHLLNAHGLDEAGIDGGGIFREFLNEL
LKSGFNPNQGFFKTTNEGLLYPNPAAQMLVGDSFARHYYFLGRMLGKALYENMLVELPFA
GFFLSKLLGTSADVDIHHLASLDPEVYKNLLFLKSYEDDVEELGLNFTVVNNDLGEAQVV
ELKFGGKDIPVTSANRIAYIHLVADYRLNRQIRQHCLAFRQGLANVVSLEWLRMFDQQEI
QVLISGAQVPISLEDLKSFTNYSGGYSADHPVIKVFWRVVEGFTDEEKRKLLKFVTSCSR
PPLLGFKELYPAFCIHNGGSDLERLPTASTCMNLLKLPEFYDETLLRSKLLYAIECAAGF
ELS