ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

9641

Name

IKBKE

Synonym

IKK-E|IKK-i|IKKE|IKKI;inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase epsilon;IKBKE;inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase epsilon

Definition

I-kappa-B kinase epsilon|IKK-epsilon|IKK-related kinase epsilon|inducible I kappa-B kinase|inducible IkappaB kinase|inhibitor of nuclear factor kappa-B kinase subunit epsilon

Position

1q32.1

Gene Type

protein-coding

Pathways and Diseases

Pathway

Signaling in Immune system;Reactome;REACT:6900

Pathway

Toll-like receptor signaling pathway;KEGG PATHWAY;hsa04620

Pathway

RIG-I-like receptor signaling pathway;KEGG PATHWAY;hsa04622

Pathway

Cytosolic DNA-sensing pathway;KEGG PATHWAY;hsa04623

Pathway

Hepatitis C;KEGG PATHWAY;hsa05160

Pathway

Toll receptor signaling pathway;PANTHER;P00054

Disease

Infection;FunDO

Disease

Breast cancer;FunDO

Disease

Squamous cell cancer;FunDO

Disease

Polyarthritis;FunDO

Disease

Rheumatoid arthritis;FunDO

External Links

Links to cell senescence gene database

9641

Links to epithelial mesenchymal transition gene database

9641

Links to ovarian cancer gene database

9641

Links to endometrial cancer gene database

9641

Links to iHOP

9641

Sequence Information

Nucleotide Sequence

>9641 : length: 3492
AGATGCCAAAACAGCACCCAGCTGCCCATCAAGATTACCAGAAGGGCCCCAGTTCCTGGC
TTCTCTGTGGCTCACACTCTGGTCCTATTGCCTACCCTTGGGAACTCAGAGCATCCTCTT
TCTCTTTTCTGCTGAGCTGGTGGCTGCACCGAGTTGCCTCTGTCTCTTTAAGAGAGAAAG
AGAGAGCGAGAGACGGAAATCAGGAAGTGCGAGAGAGCTGAGAGCCAGGACTCAGTGCTG
AGCTTGGTGTCCCACCGCCACAAGGAGGCAGGGAAGAAACCCACTAGTCCCAGCTCCTGG
GGTGGCACAGACATTGCAACTGGCCCTGCCTGTGGGTCCTAGGGGCCCTTGGCTACCAGG
AGGCTAAGAACACTGCTCATGAATGACAGTGAGCCCTGAAAGCTCTGGGGGTGTCACCCA
GTCCCACAAGCCTGCATCCCCTGCAGTGGAGATGGGCTCAGCTCCTGGACGTGCCACAGA
CAGAAAGCATAACATACACTCGCCAGGAAGAGCCTTTGCCTGACTCAGGGCAGCTCAGAG
TGTGGGGCAGAAGGTGACCAGCCAGCTCAGGGCAGGAGATGCAGAGCACAGCCAATTACC
TGTGGCACACAGATGACCTGCTGGGGCAGGGGGCCACTGCCAGTGTGTACAAGGCCCGCA
ACAAGAAATCCGGAGAGCTGGTTGCTGTGAAGGTCTTCAACACTACCAGCTACCTGCGGC
CCCGCGAGGTGCAGGTGAGGGAGTTTGAGGTCCTGCGGAAGCTGAACCACCAGAACATTG
TCAAGCTCTTTGCGGTGGAGGAGACGGGCGGAAGCCGGCAGAAGGTACTGGTGATGGAGT
ACTGCTCCAGTGGGAGCCTGCTGAGTGTGCTGGAGAGCCCTGAGAATGCCTTTGGGCTGC
CTGAGGATGAGTTCCTGGTGGTGCTGCGCTGTGTGGTGGCCGGCATGAACCACCTGCGGG
AGAACGGCATTGTGCATCGCGACATCAAGCCGGGGAACATCATGCGCCTCGTAGGGGAGG
AGGGGCAGAGCATCTACAAGCTGACAGACTTCGGCGCTGCCCGGGAGCTGGATGATGATG
AGAAGTTCGTCTCGGTCTATGGGACTGAGGAGTACCTGCATCCCGACATGTATGAGCGGG
CGGTGCTTCGAAAGCCCCAGCAAAAAGCGTTCGGGGTGACTGTGGATCTCTGGAGCATTG
GAGTGACCTTGTACCATGCAGCCACTGGCAGCCTGCCCTTCATCCCCTTTGGTGGGCCAC
GGCGGAACAAGGAGATCATGTACCGGATCACCACGGAGAAGCCGGCTGGGGCCATTGCAG
GTGCCCAGAGGCGGGAGAACGGGCCCCTGGAGTGGAGCTACACCCTCCCCATCACCTGCC
AGCTGTCACTGGGGCTGCAGAGCCAGCTGGTGCCCATCCTGGCCAACATCCTGGAGGTGG
AGCAGGCCAAGTGCTGGGGCTTCGACCAGTTCTTTGCGGAGACCAGTGACATCCTGCAGC
GAGTTGTCGTCCATGTCTTCTCCCTGTCCCAGGCAGTCCTGCACCACATCTATATCCATG
CCCACAACACGATAGCCATTTTCCAGGAGGCCGTGCACAAGCAGACCAGTGTGGCCCCCC
GACACCAGGAGTACCTCTTTGAGGGTCACCTCTGTGTCCTCGAGCCCAGCGTCTCAGCAC
AGCACATCGCCCACACGACGGCAAGCAGCCCCCTGACCCTCTTCAGCACAGCCATCCCTA
AGGGGCTGGCCTTCAGGGACCCTGCTCTGGACGTCCCCAAGTTCGTCCCCAAAGTGGACC
TGCAGGCGGATTACAACACTGCCAAGGGCGTGTTGGGCGCCGGCTACCAGGCCCTGCGGC
TGGCACGGGCCCTGCTGGATGGGCAGGAGCTAATGTTTCGGGGGCTGCACTGGGTCATGG
AGGTGCTCCAGGCCACATGCAGACGGACTCTGGAAGTGGCAAGGACATCCCTCCTCTACC
TCAGCAGCAGCCTGGGAACTGAGAGGTTCAGCAGCGTGGCTGGAACGCCTGAGATCCAGG
AACTGAAGGCGGCTGCAGAACTGAGGTCCAGGCTGCGGACTCTAGCGGAGGTCCTCTCCA
GATGCTCCCAAAATATCACGGAGACCCAGGAGAGCCTGAGCAGCCTGAACCGGGAGCTGG
TGAAGAGCCGGGATCAGGTACATGAGGACAGAAGCATCCAGCAGATTCAGTGCTGTTTGG
ACAAGATGAACTTCATCTACAAACAGTTCAAGAAGTCTAGGATGAGGCCAGGGCTTGGCT
ACAACGAGGAGCAGATTCACAAGCTGGATAAGGTGAATTTCAGTCATTTAGCCAAAAGAC
TCCTGCAGGTGTTCCAGGAGGAGTGCGTGCAGAAGTATCAAGCGTCCTTAGTCACACACG
GCAAGAGGATGAGGGTGGTGCACGAGACCAGGAACCACCTGCGCCTGGTTGGCTGTTCTG
TGGCTGCCTGTAACACAGAAGCCCAGGGGGTCCAGGAGAGTCTCAGCAAGCTCCTGGAAG
AGCTATCTCACCAGCTCCTTCAGGACCGAGCAAAGGGGGCTCAGGCCTCGCCGCCTCCCA
TAGCTCCTTACCCCAGCCCTACACGAAAGGACCTGCTTCTCCACATGCAAGAGCTCTGCG
AGGGGATGAAGCTGCTGGCATCTGACCTCCTGGACAACAACCGCATCATCGAACGGCTAA
ATAGAGTCCCAGCACCTCCTGATGTCTGAGCTCCATGGGGCACATGAGGCATCCTGAAGC
ATTAGAATGATTCCAACACTGCTCTTCTGCACCATGAGACCAACCCAGGGCAAGATCCCA
TCCCATCACATCAGCCTACCTCCCTCCTGGCTGCTGGCCAGGATGTCGCCAGCATTACCT
TCCACTGCCTTTCTCCCTGGGAAGCAGCACAGCTGAGACTGGGCACCAGGCCACCTCTGT
TGGGACCCACAGGAAAGAGTGTGGCAGCAACTGCCTGGCTGACCTTTCTATCTTCTCTAG
GCTCAGGTACTGCTCCTCCATGCCCATGGCTGGGCCGTGGGGAGAAGAAGCTCTCATACG
CCTTCCCACTCCCTCTGGTTTATAGGACTTCACTCCCTAGCCAACAGGAGAGGAGGCCTC
CTGGGGTTTCCCCAGGGCAGTAGGTCAAACGACCTCATCACAGTCTTCCTTCCTCTTCAA
GCGTTTCATGTTGAACACAGCTCTCTCCGCTCCCTTGTGATTTCTGAGGGTCACCACTGC
CAGCCTCAGGCAACATAGAGAGCCTCCTGTTCTTTCTATGCTTGGTCTGACTGAGCCTAA
AGTTGAGAAAATGGGTGGCCAAGGCCAGTGCCAGTGTCTTGGGGCCCCTTTGGCTCTCCC
TCACTCTCTGAGGCTCCAGCTGGTCCTGGGACATGCAGCCAGGACTGTGAGTCTGGGCAG
GTCCAAGGCCTGCACCTTCAAGAAGTGGAATAAATGTGGCCTTTGCTTCTGTTTAAAAAA
AAAAAAAAAAAA

Protein Sequence

>9641 : length: 716
MQSTANYLWHTDDLLGQGATASVYKARNKKSGELVAVKVFNTTSYLRPREVQVREFEVLR
KLNHQNIVKLFAVEETGGSRQKVLVMEYCSSGSLLSVLESPENAFGLPEDEFLVVLRCVV
AGMNHLRENGIVHRDIKPGNIMRLVGEEGQSIYKLTDFGAARELDDDEKFVSVYGTEEYL
HPDMYERAVLRKPQQKAFGVTVDLWSIGVTLYHAATGSLPFIPFGGPRRNKEIMYRITTE
KPAGAIAGAQRRENGPLEWSYTLPITCQLSLGLQSQLVPILANILEVEQAKCWGFDQFFA
ETSDILQRVVVHVFSLSQAVLHHIYIHAHNTIAIFQEAVHKQTSVAPRHQEYLFEGHLCV
LEPSVSAQHIAHTTASSPLTLFSTAIPKGLAFRDPALDVPKFVPKVDLQADYNTAKGVLG
AGYQALRLARALLDGQELMFRGLHWVMEVLQATCRRTLEVARTSLLYLSSSLGTERFSSV
AGTPEIQELKAAAELRSRLRTLAEVLSRCSQNITETQESLSSLNRELVKSRDQVHEDRSI
QQIQCCLDKMNFIYKQFKKSRMRPGLGYNEEQIHKLDKVNFSHLAKRLLQVFQEECVQKY
QASLVTHGKRMRVVHETRNHLRLVGCSVAACNTEAQGVQESLSKLLEELSHQLLQDRAKG
AQASPPPIAPYPSPTRKDLLLHMQELCEGMKLLASDLLDNNRIIERLNRVPAPPDV