ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

9623

Name

TCL1B

Synonym

SYN-1|TML1;T-cell leukemia/lymphoma 1B;TCL1B;T-cell leukemia/lymphoma 1B

Definition

T-cell leukemia/lymphoma protein 1B|T-cell lymphoma/leukemia 1B|TCL1/ MTCP1-like 1|oncogene TCL-1B|syncytiotrophoblast-specific protein

Position

14q32.1

Gene Type

protein-coding

External Links

Links to cell senescence gene database

9623

Links to epithelial mesenchymal transition gene database

9623

Links to ovarian cancer gene database

9623

Links to endometrial cancer gene database

9623

Links to iHOP

9623

Sequence Information

Nucleotide Sequence

>9623 : length: 1172
TGGAAAGCTACACGTGTGAGCCTAGAGGCGGGTCCCGGTTGCAGACTTGCCATGGCCTCC
GAAGCTTCTGTGCGTCTAGGGGTGCCCCCTGGCCGTCTGTGGATCCAGAGGCCTGGCATC
TACGAAGATGAGGAGGGGAGAACCTGGGTGACTGTGGTCGTGCGGTTCAATCCCTCGCGT
AGGGAATGGGCCAGGGCCTCCCAGGGCAGCAGATATGAACCCAGCATCACAGTGCACTTG
TGGCAGATGGCAGTGCATACCCGGGAGCTACTCTCCTCCGGCCAGATGCCCTTCTCCCAG
CTGCCCGCCGTGTGGCAGCTCTACCCCGGGAGGAAGTACCGAGCAGCGGATTCCAGTTTC
TGGGAAATAGCAGACCATGGCCAGATTGACTCTATGGAGCAGCTGGTCCTAACATATCAG
CCGGAGAGGAAAGACTGACACTGGGAGTGGCTGGCCCTGCTGGCCCTGCCTCTTCTGGCC
TGGTGTCTCCTCATGCCCCCTCAGTGAGGATCTTCATGTACCTGCTCTTCTGTTTGCACA
CCCAGCATAGCCTCCTTGCAGGCAGAAGGCAGTAGGGCCCCTGCACACTCAGTTTCTCTC
GTTTTCCTTAGTTATCAGTCCTGTCCTGTCCCACTCAGGTCTGTACTTAGGGCAGCTGGC
CTGGATGGGCTTCACTGGGGCCCTGTCTGTGTGCTGAGCCAGTTTCCCCTGCTGGCTGCA
AGCTGTGGGTTCTTTCTCCTCTGTGCCCCTCATGCTGATCTTCTAGATGCCACTCCCAAA
TCCCCTTCATACCCACCAGGATGTGTGCCCAGCCAGGCCTCCAGCACCCCCAGTGCAGCT
CGTGATTGGAAACTCACCATCGGCAGGCAGTGGTTCGGTTTAAGAGATGGCATTAGAGGG
AGCCCAGTCTGGATGTGGACTTGGATGCCCTGTGGGTATCAGTTCTGCTGACACTTTGGC
CCGAAATAGATCCAGTGCTGAGCAAGCAATGTACACCAGAGCCTCAGTGAGCCCATCTGC
ACAGTGGGGAGCATGGAGGGATGGGTTTGGCCTGTGCTTCTGCTTATTCAGTCCTTCAGC
TCACGGAAGGGATGCTAGTCCGTGAAGGTGACCTCACAGTACTGGTTAATTAAACTTTAT
TGCTCACTGTCCACTTTTGTGCTGAAAAAAAA

Protein Sequence

>9623 : length: 128
MASEASVRLGVPPGRLWIQRPGIYEDEEGRTWVTVVVRFNPSRREWARASQGSRYEPSIT
VHLWQMAVHTRELLSSGQMPFSQLPAVWQLYPGRKYRAADSSFWEIADHGQIDSMEQLVL
TYQPERKD