ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

957

Name

ENTPD5

Synonym

CD39L4|NTPDase-5|PCPH;ectonucleoside triphosphate diphosphohydrolase 5;ENTPD5;ectonucleoside triphosphate diphosphohydrolase 5

Definition

CD39 antigen-like 4|CD39-like 4|ER-UDPase|GDPase ENTPD5|NTPDase 5|Pcph proto-oncogene protein|UDPase ENTPD5|guanosine-diphosphatase ENTPD5|nucleoside diphosphatase|proto-oncogene CPH|uridine-diphosphatase ENTPD5

Position

14q24

Gene Type

protein-coding

Pathways and Diseases

Pathway

Pyrimidine metabolism;KEGG PATHWAY;hsa00240

Pathway

Purine metabolism;KEGG PATHWAY;hsa00230

External Links

Links to cell senescence gene database

957

Links to epithelial mesenchymal transition gene database

957

Links to ovarian cancer gene database

957

Links to endometrial cancer gene database

957

Links to iHOP

957

Sequence Information

Nucleotide Sequence

>957 : length: 5854
TGCCTCAGGAGACTTAGATCCCCGCTGATCCGCCCGTCCCGCCGCAGTGGTCTGAGCCGC
AGCCCTTTCCCGTGCCGCCCGCGGGTCCCGTTCCTCCCGTGTCTCCATGCCGCAGCCAGC
GTGGCCGCGGCTACCTTGCCCTCGCCCCCGCTCCGCTTCTGCCGCTCCCGGCACTGCCTT
ACTCCTTTGGGTTGCATCTCTTTCCTGGCTTTTCACCCTTGCTGATTCTGTAAGGGATAG
TGCAGCCAGCGGACGTCCCAGGCCAAATGTTTTTTGATAGGCAGTCGAGGACTTTCCCGA
GGGCGGTGGTTGAGGGCGAGGCTGCCAGCCTCCGAAGAGCAGCGGCACGCCAGGGAGCCG
GGCGGGGAGGGGAGTGCTGCCACCGAGGTCGGGAGCAGGGTCCTCGGCCTCACTAGGTCC
TGTGTGGCCGATACTTCCTGCCCACGACCGCCCCCCGGATTTCCATTTGCTAATACCGGT
CCGCAGCCTTCTTTCCTGAAAGTTGCATAAAGTTGGAAGCTCTTCAACTTGCCTCCCCGA
CTCCTGAAATCCCGAATACACCTCTGAAAAGGAGTGTACTCACAAGTATTCTCATTTTTC
AATGAGAGTCAGTCAGTGAGTCATTAAGGAAGTTTTCCTTGTTCCTGGTCAACAAAGAAA
TGTGGAGTGTCTTGGCTGAATCCTCATACAGACAAGATCATTATGGTGCTGTTAGGTAGG
ACTTGTATCCAGATGTAAGGTTGAAAAAGTGATATAATAAAGGAACCAAGGAGAAAATTC
AGAAGGAAAGAAAAAATTGCCTCTGCAGGTGTGCGAGCAGGATTGCTTCTGCAACAAAAG
CCTCCACCCAGCCACATCTTGGGAAAAGAATGGCCACTTCTTGGGGCACAGTCTTTTTCA
TGCTGGTGGTATCCTGTGTTTGCAGCGCTGTCTCCCACAGGAACCAGCAGACTTGGTTTG
AGGGTATCTTCCTGTCTTCCATGTGCCCCATCAATGTCAGCGCCAGCACCTTGTATGGAA
TTATGTTTGATGCAGGGAGCACTGGAACTCGAATTCATGTTTACACCTTTGTGCAGAAAA
TGCCAGGACAGCTTCCAATTCTAGAAGGGGAAGTTTTTGATTCTGTGAAGCCAGGACTTT
CTGCTTTTGTAGATCAACCTAAGCAGGGTGCTGAGACCGTTCAAGGGCTCTTAGAGGTGG
CCAAAGACTCAATCCCCCGAAGTCACTGGAAAAAGACCCCAGTGGTCCTAAAGGCAACAG
CAGGACTACGCTTACTGCCAGAACACAAAGCCAAGGCTCTGCTCTTTGAGGTAAAGGAGA
TCTTCAGGAAGTCACCTTTCCTGGTACCAAAGGGCAGTGTTAGCATCATGGATGGATCCG
ACGAAGGCATATTAGCTTGGGTTACTGTGAATTTTCTGACAGGTCAGCTGCATGGCCACA
GACAGGAGACTGTGGGGACCTTGGACCTAGGGGGAGCCTCCACCCAAATCACGTTCCTGC
CCCAGTTTGAGAAAACTCTGGAACAAACTCCTAGGGGCTACCTCACTTCCTTTGAGATGT
TTAACAGCACTTATAAGCTCTATACACATAGTTACCTGGGATTTGGATTGAAAGCTGCAA
GACTAGCAACCCTGGGAGCCCTGGAGACAGAAGGGACTGATGGGCACACTTTCCGGAGTG
CCTGTTTACCGAGATGGTTGGAAGCAGAGTGGATCTTTGGGGGTGTGAAATACCAGTATG
GTGGCAACCAAGAAGGGGAGGTGGGCTTTGAGCCCTGCTATGCCGAAGTGCTGAGGGTGG
TACGAGGAAAACTTCACCAGCCAGAGGAGGTCCAGAGAGGTTCCTTCTATGCTTTCTCTT
ACTATTATGACCGAGCTGTTGACACAGACATGATTGATTATGAAAAGGGGGGTATTTTAA
AAGTTGAAGATTTTGAAAGAAAAGCCAGGGAAGTGTGTGATAACTTGGAAAACTTCACCT
CAGGCAGTCCTTTCCTGTGCATGGATCTCAGCTACATCACAGCCCTGTTAAAGGATGGCT
TTGGCTTTGCAGACAGCACAGTCTTACAGCTCACAAAGAAAGTGAACAACATAGAGACGG
GCTGGGCCTTGGGGGCCACCTTTCACCTGTTGCAGTCTCTGGGCATCTCCCATTGAGGCC
ACGTACTTCCTTGGAGACCTGCATTTGCCAACACCTTTTTAAGGGGAGGAGAGAGCACTT
AGTTTCTGAACTAGTCTGGGGACATCCTGGACTTGAGCCTAGAGATTTAGGTTTAATTAA
TTTTACACATCTAATGTGAACTGCTGCCTAACCACTCAAGAGTACACAGCTGGCACCAGA
GCATCACAGAGAGCCCTGTGAGCCAAAAAGTATAGTTTTGGAACTTAACCTTGGAGTGAG
AGCCCAGGGACAGGTCCCTGGAAACCAAAGAAAAATCGCATTTCAACCCTTTGAGTGCCT
CATTCCACTGAATATTTAAATTTTCCTCTTAAATGGTAAACTGACTTATTGCAATCCCAA
GACCCATCAATATCAGTATTTTTTTCCTCCCTATACAGTGCCCTGCCCACCCTTATCTGC
ACCCACCTCCCCTGAAAAAGAGAGAAAAAAAAAAACCTGGTTTTGCTTTCCATGTATAAT
TCAACAACGCAAAATGGGACCATGTCAGAATCTGTATGATCCTATTCTGTGTTAGCTCCA
ATCAGCCAGCTGAGAGCCATCCTAAATATTAATAGGATGAGAGAGTAACTCCTAACTGTG
CATAAATTACAGCCTTAAGAAAGAAGGCCACCCGGTCTCTGGGGACATGTTTTGGGAGGG
TGTGGCTGCCTCATATAGCCTACCTTTGCTTTAATCAGCATTTTATCAGTCAACTCTGGG
ATTAATGAACATATCCGACTTTATGGGTATGTGTATATTCAGTGCCAGTACCACCTCCCA
GGCTAATGTGTTAACAGTGTTTTCTATGATTCTAAACTTGTTTTCTTTGTATTTCTAAGA
AATACAACTAGGCCCTAACTTTTGGTCTGTGGTCAGAGGTCAGTGTCTGTGCTATTCCAG
GATCTATTATTTCAGTTTGCCCTTTTATTCTCTCCGTTTGTAACAGTACCTTCCTGTCCT
GGTCCCTGATCACTTTAGCTAATATCCTTTGAATTATTTATCTAGTTCAGAGTTTCCAAT
ACCGTTCCTGACAAAACCCCACTTGGATTTGGTTGGCTCTCTCAGCCCACATCAGTACAG
TGGACCAACATTTCCAGGGAGAACCATATTTAATGTCCCTCATGCTCTCTTTTTGAATCC
AAGTGCTCAGAGCTCTTGACTGTGAATTATTTACCCCAAATTCATTATCTTGCACTTTTT
TTTGAGATGGAGTCTTGCTCTGTTGCTCAGGCTAGAGTGGAGTGGCGCAATCTCAGCTCA
CTGCAACCTCCGCCCCCAGGTTCAAGCGATTCTTGTTCTCAGCCTCCTGAAGAGCTGGGA
TTACAGGTGCCCACCACCATTCCTGGCTAATTTTTGTATTTGTAGTAGAGATGGGGTTTC
ACCATGTTGGCCAGGCTGGTTTCCAACTCCTGATCTCAATTGATCCACCCGCTTCCCAAA
GTGCTGGGATTACAGGCATGAGACACCGCGCCTGGCCTTATCTTGCACTTTCAACATAAT
CATCCCTGCTTCTCATCTGCCCTGCAGTGCTCTTGGACCTGGAAGATCTCCCTGTGGTCT
GGCCCCTTTGCCTTGGTTGTTAACCTCCAGCTTCTTTGCAGGAGTGTATTTCCCCAAAAC
TTGTGGCTTTCACAGTAGACTCCGTTTCCATCCTCTCTCTCACAAAGGATGTTAAGTATG
CCTGGCCCTCACACAGTCCATGGGAAACCTTATTTTTAACATTACTCCATTGAGTCAATA
AATATTTACCATCTGCTGTGTGCAAGTTACTAGGCAAATTTCTGTATCCTTGTCCCTAAA
ATTCTTGTCTTTAAATTCATTGTGGAATTTCTTTAGACTTCACACTGACTTTTATTACTA
AGGTCACCTTTATACCAACTGCCTTCCTCAAAATGCTTATAATGAAATAACAGAATCTTG
AGTTGGAAACAGCCCAAAGAAATAATCCAATGTTGTACTCAGTGCAGAATTCCCTAGAAT
TTCTAACAGGTTGTCATTCAGCTTCTGCTAAGCCATGTTCAAACAGCTTATTCCATTTGG
AACTGCACTGATATTAAAAAAAATTCCTTATATTGAGCTGAAATCTACCTATCTTCTAAG
TGGTCTTAGTTCTGCTCTAATCTCTCCTTCCAAAATCTTTGGATCTTTTGAAAAAAGTTC
CTCCCAAGTTCTTTTATAAGTGACATGACTTTTAGACCCCTTCCCATCTTTGTCAACAAA
AGTAGGGTGCCAGACCAGTCACAGAACACTAAATGTCATCCATGTTTCCTTCAGTAGAAA
CCAGCAGTTTTAAAAGAGGTAAGCTGTGTTCACTAAAGACTGTTCCAGCTTGACAAATGC
AGAGATATAAGTCTCTGGTCTTTAATCACTGTGGGGGCCATTTTGTAAAACACACATACT
GTCCAGCAGACTCCTTTGGTCATCCCAAATACCTCTGAACTCCAGGGAAGATGCATTCTA
ACTCCACGAACTTACCTATTTTGTTAACCTTGATTAGACCTTCTGGAGAAGTAACCAATT
TGTCCATCTTAGGAGCAATTTGGAATGAGAGTTTTTATTTTTTTCTGTAACGCCCATCCT
GCCTGCAGTAGACCCTTTGGGCTTAAGAGGTCCTACAGATTCTAATAGTTTCCTCTTTGT
AGATGTGTTAACATATTTAAAATACTTAGGACATGGCCTGGTACGTGACAGATGGTGTTT
AACATCATTGTCATATGAAGAACACTCTCTGTGGGCCAATGGAGGTGTGCCTTAAAATTC
TTCATCTTGCCTGATTTTGTTTGCATAACTTCTGGAGAGTCTGTGTCCTCCTCATCTAGG
CCACCTTTCCATTTTTTGTGAAAGATGACCTTGTCCCTGCAGTCTCCGCCAGGAGTCACA
CAGCTTTTCACAGCAGCTGCCATCTTTAATTCTTTTTCCTGAGATTCCAGCAAGGTTGTG
ACATTGTCACTTTTTTGTTCTAGACTCTTTTAAATTTTCTGCATTTGCCTGAAAAGCACC
CCTGTAAGAATAGATTTCTCATGGCTCTAAAAATTATTCCCAAGAATACCTTACTTGGTT
CAAAAGCAGACTGTTTCTCTTCATTTCATCTCAAATCAGACTTCTGGGCAAGATGTTCTT
TAGAGTAAGCAAACCTACAACCTAAAAATCTCTTCAAGAGGCATCTCTGGTCTTGTGACG
AGACCTCTTCAAAAACCCACAGTAAAACTCCCCTCCCTCCAGTTGGCCACCAGTCTGCCA
CCAAACATGAACAAATTCTGCTGCTAATCGGTTTCCCTTGTGATCTGGTTCCTGAGGTCT
TCGGATCTGTGCAATGAATTATTTATTGTTTTATTAAACCGACAGTGGTGTCCCAGAGAG
GAACCATAAATAAAATGGAAATCTGGTGCTGTGATAAAGTAATAACTAGCATTAATGAGA
CCTGGTTTTCCTTTCAGAAAGTCCAGTATACCTGTAACAAAGGTTAAAGCAATTTATATT
TAATTTGCATTCTGATGTTAACATTTAAACAGCAATTCTAACAAAAATGCATCGAGTCTA
ATTCTTACCTCTATCAAAAAACAACTGTATAAATTTATGACCAACATTAAAACAAAAACA
AAATGTAAATTTTCTCTTTAGAAATGATTAACTGGAAATGAGTGAGACAGCACCTTGTGG
GTTTTTTAGTAATAAAAAGCTCTTTTCAACCAAA

Protein Sequence

>957 : length: 428
MATSWGTVFFMLVVSCVCSAVSHRNQQTWFEGIFLSSMCPINVSASTLYGIMFDAGSTGT
RIHVYTFVQKMPGQLPILEGEVFDSVKPGLSAFVDQPKQGAETVQGLLEVAKDSIPRSHW
KKTPVVLKATAGLRLLPEHKAKALLFEVKEIFRKSPFLVPKGSVSIMDGSDEGILAWVTV
NFLTGQLHGHRQETVGTLDLGGASTQITFLPQFEKTLEQTPRGYLTSFEMFNSTYKLYTH
SYLGFGLKAARLATLGALETEGTDGHTFRSACLPRWLEAEWIFGGVKYQYGGNQEGEVGF
EPCYAEVLRVVRGKLHQPEEVQRGSFYAFSYYYDRAVDTDMIDYEKGGILKVEDFERKAR
EVCDNLENFTSGSPFLCMDLSYITALLKDGFGFADSTVLQLTKKVNNIETGWALGATFHL
LQSLGISH