ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

9557

Name

CHD1L

Synonym

ALC1|CHDL;chromodomain helicase DNA binding protein 1-like;CHD1L;chromodomain helicase DNA binding protein 1-like

Definition

amplified in liver cancer 1|amplified in liver cancer protein 1|chromodomain-helicase-DNA-binding protein 1-like

Position

1q12

Gene Type

protein-coding

Pathways and Diseases

Pathway

Wnt signaling pathway;PANTHER;P00057

Disease

Carcinoma;FunDO

Disease

protein quantitative trait loci;GAD

Disease

Protein quantitative trait loci;NHGRI

External Links

Links to cell senescence gene database

9557

Links to epithelial mesenchymal transition gene database

9557

Links to ovarian cancer gene database

9557

Links to endometrial cancer gene database

9557

Links to iHOP

9557

Sequence Information

Nucleotide Sequence

>9557 : length: 3036
GCGTTGGGAAGTTGGGAGGGAGGTGCGCGCTTGGCCGCGCGGGGCGGGGCCTCTACCGGC
CCGATGGAGCGCGCGGGCGCTACTAGCCGCGGGGGCCAAGCGCCTGGCTTCTTACTGCGG
CTTCATACTGAGGGCCGAGCCGAGGCGGCGCGGGTGCAGGAGCAGGACTTACGGCAGTGG
GGGCTGACAGGGATTCACCTACGCTCTTACCAGCTGGAGGGAGTAAACTGGCTCGCCCAG
CGCTTCCATTGTCAGAATGGCTGTATCCTGGGAGATGAGATGGGCCTGGGGAAGACCTGC
CAGACTATTGCTCTCTTCATTTATTTGGCAGGAAGATTAAATGATGAAGGGCCATTTCTG
ATTCTTTGTCCCTTGTCTGTTTTGAGCAACTGGAAAGAAGAAATGCAGAGATTTGCTCCA
GGTCTTTCCTGTGTAACATATGCAGGCGACAAGGAGGAAAGAGCCTGCCTTCAGCAAGAC
CTGAAACAGGAGTCACGTTTTCATGTGCTACTGACTACCTATGAGATTTGCTTGAAAGAT
GCATCATTTCTAAAATCATTCCCTTGGAGTGTTCTTGTTGTGGATGAAGCTCACAGGTTG
AAAAACCAAAGCTCCCTGCTGCATAAGACCTTGTCAGAGTTCTCAGTAGTCTTCAGTCTC
CTGTTGACCGGAACTCCCATCCAGAACAGCCTCCAAGAGCTCTACTCCCTCCTCAGTTTT
GTGGAGCCTGATCTCTTTTCCAAGGAAGAGGTGGGAGATTTTATTCAACGCTACCAGGAT
ATTGAGAAAGAATCTGAGTCAGCAAGTGAACTGCACAAACTCTTGCAGCCATTTCTGCTG
AGGCGAGTGAAAGCTGAGGTAGCTACAGAGCTTCCCAAGAAGACAGAAGTAGTGATATAC
CATGGCATGTCAGCATTGCAGAAGAAATACTACAAGGCCATTTTGATGAAAGACCTAGAT
GCATTTGAAAATGAGACGGCAAAGAAAGTTAAACTACAGAACATTTTGTCCCAGCTTCGA
AAGTGTGTGGATCACCCATATTTGTTTGATGGTGTGGAGCCGGAGCCTTTTGAAGTTGGA
GACCACCTGACTGAGGCTAGTGGGAAGCTTCACCTGCTGGATAAGCTACTAGCATTCCTG
TATTCTGGGGGCCATCGGGTTTTACTTTTCTCCCAAATGACCCAGATGTTGGATATTCTC
CAAGACTATATGGATTACAGAGGCTACAGCTATGAGCGTGTGGATGGTTCTGTGAGAGGA
GAAGAGAGACACTTGGCCATTAAGAACTTTGGACAGCAGCCCATTTTCGTTTTTCTCCTG
AGTACTAGGGCAGGTGGAGTTGGCATGAACTTAACAGCAGCAGATACTGTGATTTTTGTT
GACAGTGACTTTAATCCTCAGAATGACTTGCAAGCAGCTGCCAGGGCTCATCGCATTGGC
CAAAACAAGTCTGTTAAAGTTATTCGGCTGATTGGTCGAGACACTGTGGAAGAAATAGTC
TATAGGAAAGCAGCCTCCAAACTGCAGCTCACCAACATGATCATAGAAGGAGGCCATTTT
ACTCTGGGAGCCCAGAAACCCGCTGCCGATGCTGACCTCCAGTTGAGTGAGATACTCAAA
TTTGGTTTGGATAAACTGCTGGCCTCTGAGGGGAGCACCATGGATGAAATAGACCTGGAG
TCCATCCTGGGAGAAACAAAAGATGGCCAGTGGGTCTCTGATGCCTTGCCTGCAGCAGAA
GGAGGGAGCAGAGATCAAGAGGAAGGAAAAAATCATATGTACTTATTTGAAGGTAAAGAT
TATTCTAAAGAGCCCAGTAAGGAAGACAGAAAATCATTTGAACAACTGGTAAACCTTCAG
AAAACCCTTTTGGAGAAAGCTAGTCAAGAGGGCCGATCACTCCGAAATAAAGGCAGTGTT
CTCATCCCAGGCCTTGTGGAGGGATCTACCAAAAGGAAGCGGGTTCTGAGTCCAGAAGAG
CTGGAGGACAGACAGAAGAAAAGACAAGAAGCAGCTGCCAAGAGAAGGAGACTCATAGAG
GAGAAGAAGAGGCAAAAGGAAGAGGCTGAACATAAGAAAAAGATGGCCTGGTGGGAATCC
AACAATTACCAGTCCTTCTGCCTGCCCTCTGAGGAGAGCGAGCCAGAGGACCTTGAGAAT
GGGGAAGAGAGCTCTGCTGAGCTGGATTACCAAGACCCAGATGCTACTTCCCTCAAGTAC
GTTAGTGGTGATGTCACCCACCCTCAGGCTGGGGCCGAGGATGCTCTCATTGTGCACTGC
GTAGATGACTCTGGCCACTGGGGCAGAGGTGGTTTATTTACAGCTCTGGAAAAGCGATCC
GCTGAGCCAAGAAAAATATATGAGCTGGCTGGGAAAATGAAAGACCTGAGTTTGGGAGGT
GTCCTTTTATTTCCTGTTGATGATAAAGAATCAAGAAACAAAGGGCAAGATTTGTTGGCC
TTGATTGTGGCTCAGCATCGTGATCGTTCCAATGTCCTGTCTGGCATTAAGATGGCAGCC
CTAGAAGAGGGCCTGAAGAAGATATTTTTAGCAGCAAAAAAGAAGAAAGCAAGTGTTCAT
CTTCCACGTATTGGACATGCCACGAAAGGTTTTAACTGGTATGGTACTGAGCGACTTATT
CGGAAACATCTGGCTGCAAGAGGCATCCCAACTTACATATATTATTTTCCTAGAAGCAAG
TCTGCTGTCCTTCATTCACAGTCTTCATCTTCCTCCTCAAGACAGCTGGTGCCTTAAGAA
TTGGCCCAGCCTCAGATCCTGTCTTTAGCAACCAGCTAATATTTACCCAGAGGTACTGCA
ATAGAGTATTTCAAAATGGAATCAGGATCTGGTGGGCCTCAGAAATTGTCTCTTTTCTGA
GTTTCAATTTGGTTCTCCTGGATGTTTTGCTCTGTTTTGGTACCTGTAATATAGGGAAAC
ACAACTTTTTTTGGGAAAGCCCTTTGACCCCAGCTTGCTAGTTGCATAATAATAAATTTT
CTGTTCCTAATGGTAAAAAAAAAAAAAAAAAAAAAA

Protein Sequence

>9557 : length: 897
MERAGATSRGGQAPGFLLRLHTEGRAEAARVQEQDLRQWGLTGIHLRSYQLEGVNWLAQR
FHCQNGCILGDEMGLGKTCQTIALFIYLAGRLNDEGPFLILCPLSVLSNWKEEMQRFAPG
LSCVTYAGDKEERACLQQDLKQESRFHVLLTTYEICLKDASFLKSFPWSVLVVDEAHRLK
NQSSLLHKTLSEFSVVFSLLLTGTPIQNSLQELYSLLSFVEPDLFSKEEVGDFIQRYQDI
EKESESASELHKLLQPFLLRRVKAEVATELPKKTEVVIYHGMSALQKKYYKAILMKDLDA
FENETAKKVKLQNILSQLRKCVDHPYLFDGVEPEPFEVGDHLTEASGKLHLLDKLLAFLY
SGGHRVLLFSQMTQMLDILQDYMDYRGYSYERVDGSVRGEERHLAIKNFGQQPIFVFLLS
TRAGGVGMNLTAADTVIFVDSDFNPQNDLQAAARAHRIGQNKSVKVIRLIGRDTVEEIVY
RKAASKLQLTNMIIEGGHFTLGAQKPAADADLQLSEILKFGLDKLLASEGSTMDEIDLES
ILGETKDGQWVSDALPAAEGGSRDQEEGKNHMYLFEGKDYSKEPSKEDRKSFEQLVNLQK
TLLEKASQEGRSLRNKGSVLIPGLVEGSTKRKRVLSPEELEDRQKKRQEAAAKRRRLIEE
KKRQKEEAEHKKKMAWWESNNYQSFCLPSEESEPEDLENGEESSAELDYQDPDATSLKYV
SGDVTHPQAGAEDALIVHCVDDSGHWGRGGLFTALEKRSAEPRKIYELAGKMKDLSLGGV
LLFPVDDKESRNKGQDLLALIVAQHRDRSNVLSGIKMAALEEGLKKIFLAAKKKKASVHL
PRIGHATKGFNWYGTERLIRKHLAARGIPTYIYYFPRSKSAVLHAQSSSSSSRQLVP