ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

94274

Name

PPP1R14A

Synonym

CPI-17|CPI17|PPP1INL;protein phosphatase 1, regulatory (inhibitor) subunit 14A;PPP1R14A;protein phosphatase 1, regulatory (inhibitor) subunit 14A

Definition

17 kDa PKC-potentiated inhibitory protein of PP1|17-KDa protein|17-kDa PKC-potentiated inhibitory protein of PP1|PKC-potentiated inhibitory protein of PP1|protein kinase C-potentiated inhibitor protein of 17 kDa|protein phosphatase 1 regulatory subunit 14

Position

19q13.1

Gene Type

protein-coding

Pathways and Diseases

Pathway

Vascular smooth muscle contraction;KEGG PATHWAY;hsa04270

Pathway

activation of pkc through g-protein coupled receptors;PID BioCarta;100073

Pathway

pkc-catalyzed phosphorylation of inhibitory phosphoprotein of myosin phosphatase;PID BioCarta;100100

External Links

Links to cell senescence gene database

94274

Links to epithelial mesenchymal transition gene database

94274

Links to ovarian cancer gene database

94274

Links to endometrial cancer gene database

94274

Links to iHOP

94274

Sequence Information

Nucleotide Sequence

>94274 : length: 782
GCAGGGACCCGCCCGGGACTCTGGGTCCCCGCCCATACCTCAACTTCGCACGACTGCGTG
CCTCAAGCCGACGCAGCGGCCTACTCTCGCACTGCAGACGGGGAAACTGAGGCCTGAGGC
GGCCGGGGTGGGGCAGACCTCCCGGCGAGCCCGAGCCCCCGCCCCCGGCTAGCCCCGCCC
TGGCCCGTAAGAAGCACCCGGGGCGCGAGGCGAAGGCGCACAGCGCGGGGCCAGGCTGGG
TCCAGCAGCGCGATGGCAGCTCAGCGGCTGGGCAAGCGCGTGCTGAGCAAGCTGCAGTCT
CCATCGCGGGCCCGCGGGCCAGGGGGCAGTCCCGGGGGGCTGCAGAAGCGGCACGCGCGC
GTCACCGTCAAGTATGACCGGCGGGAGCTGCAGCGGCGGCTGGACGTGGAGAAGTGGATC
GACGGGCGCCTGGAGGAGCTGTACCGCGGCATGGAGGCAGACATGCCCGATGAGATCAAC
ATTGATGAATTGTTGGAGTTAGAGAGTGAAGAGGAGAGAAGCCGGAAAATCCAGGGACTC
CTGAAGTCATGTGGGAAACCTGTCGAGGACTTCATCCAGGAGCTGCTGGCAAAGCTTCAA
GGCCTCCACAGGCAGCCCGGCCTCCGCCAGCCAAGCCCCTCCCACGACGGCAGCCTCAGC
CCCCTCCAGGACCGGGCCCGGACTGCTCACCCCTGACCCTCTTGCACTCTCCCTGCCCCC
CGGACGCCGCCCAGCTTGCTTGTGTATAAGTTGTATTTAATGGTTCTGTAACAATAAAAA
AA

Protein Sequence

>94274 : length: 147
MAAQRLGKRVLSKLQSPSRARGPGGSPGGLQKRHARVTVKYDRRELQRRLDVEKWIDGRL
EELYRGMEADMPDEINIDELLELESEEERSRKIQGLLKSCGKPVEDFIQELLAKLQGLHR
QPGLRQPSPSHDGSLSPLQDRARTAHP