ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

94234

Name

FOXQ1

Synonym

HFH1;forkhead box Q1;FOXQ1;forkhead box Q1

Definition

HFH-1|HNF-3/forkhead-like protein 1|forkhead box protein Q1|hepatocyte nuclear factor 3 forkhead homolog 1|winged helix/forkhead transcription factor

Position

6p25

Gene Type

protein-coding

External Links

Links to cell senescence gene database

94234

Links to epithelial mesenchymal transition gene database

94234

Links to ovarian cancer gene database

94234

Links to endometrial cancer gene database

94234

Links to iHOP

94234

Sequence Information

Nucleotide Sequence

>94234 : length: 2338
CTCAACGTCGAACCGAAGGCGACACCCACCCAACTCCTCCCTCTCCGCCCCATAGTCCAC
CCAACACTTGCAGCCCCTCCAGAGAAAAAGCCCAGCGGAAGAGGACTCCGGAAAAGTGAC
TATCTCGGAAGACCAGGGTAGAGCTCCCGGGAGAAAAAGGCGAAGATCCCCGGCCCCGGA
TCGCCATCCCCTTCCCTGGCACCAGCTTCTCTAGGCTGCGCGAAGGAAGAGGGTACGACG
CCGGGGAGGGACTGGGTGCGCGGGCATGAAGTTGGAGGTGTTCGTCCCTCGCGCGGCCCA
CGGGGACAAGCAGGGCAGTGACCTGGAGGGCGCGGGCGGCAGCGACGCGCCGTCCCCGCT
GTCGGCGGCGGGAGACGACTCCCTGGGCTCAGATGGGGACTGCGCGGCCAACAGCCCGGC
CGCGGGCGGCGGCGCCAGAGATACGCAGGGCGACGGCGAACAGAGTGCGGGAGGCGGGCC
GGGCGCGGAGGAGGCGATCCCGGCAGCAGCTGCTGCAGCGGTGGTGGCGGAGGGCGCGGA
GGCCGGGGCGGCGGGGCCAGGCGCGGGCGGCGCGGGGAGCGGCGAGGGTGCACGCAGCAA
GCCATATACGCGGCGGCCCAAGCCCCCCTACTCGTACATCGCGCTCATCGCCATGGCCAT
CCGCGACTCGGCGGGCGGGCGCTTGACGCTGGCGGAGATCAACGAGTACCTCATGGGCAA
GTTCCCCTTTTTCCGCGGCAGCTACACGGGCTGGCGCAACTCCGTGCGCCACAACCTTTC
GCTCAACGACTGCTTCGTCAAGGTGCTGCGCGACCCCTCGCGGCCCTGGGGCAAGGACAA
CTACTGGATGCTCAACCCCAACAGCGAGTACACCTTCGCCGACGGGGTCTTCCGCCGCCG
CCGCAAGCGCCTCAGCCACCGCGCGCCGGTCCCCGCGCCCGGGCTGCGGCCCGAGGAGGC
CCCGGGCCTCCCCGCCGCCCCGCCGCCCGCGCCCGCCGCCCCGGCCTCGCCCCGCATGCG
CTCGCCCGCCCGCCAGGAGGAGCGCGCCAGCCCCGCGGGCAAGTTCTCCAGCTCCTTCGC
CATCGACAGCATCCTGCGCAAGCCCTTCCGCAGCCGCCGCCTCAGGGACACGGCCCCCGG
GACGACGCTTCAGTGGGGCGCCGCGCCCTGCCCGCCGCTGCCCGCGTTCCCCGCGCTCCT
CCCCGCGGCGCCCTGCAGGGCCCTGCTGCCGCTCTGCGCGTACGGCGCGGGCGAGCCGGC
GCGGCTGGGCGCGCGCGAGGCCGAGGTGCCACCGACCGCGCCGCCCCTCCTGCTTGCACC
TCTCCCGGCGGCGGCCCCCGCCAAGCCACTCCGAGGCCCGGCGGCCGGCGGCGCGCACCT
GTACTGCCCCCTGCGGCTGCCCGCAGCCCTGCAGGCGGCCTCAGTCCGCCGCCCTGGCCC
GCACCTGCCGTACCCGGTGGAGACGCTCCTAGCCTGAGTAGCGCCGCGGGGCCCGGGAAC
GCCGAGTGCGCGCCGTCGGGGAGGCGGGAACGCGGGCCCGCGCGCGGACTTTGCACTTTG
AATCCAGAGGAAGATGAATTTTTAAAATCTCCATCAAACGTGCCTTAAAGCTAAAGCATT
TTGACAGGAGTATTTAAACTTAGTCCAGGATATTTTCCTTTGTGTTTTATAACTTTACAG
AGGACCAAAGCAATTCTTGTTTTAGTTTCTTTGCGAAGCCTGCTCCTCCTTCCCTTCATA
AGGACTTTTTTTGTCTTTCTTTAACGCCCAGGCTTCGTCTTATTTCTACTGTTTTTGTCG
CAACTTCCATTGATTTATGTCCCTTCCCTCCCCCCTAAGTACATCAGGGAACCTTTCCAC
ACTATAAATGATATGACTACTGTTTGGGGTTTCTGGGCCCCCATCCGTGTACGTATGTGG
CATTTCCAGGTATGACTGAGTGTGAGAGACATGTCAGAGGCTCTTCAGTGATTTCTTGCT
ATTGACCGATGCTTCACTGTGCCAAAAGAGAAAAAAAATGTTGGGTTTTGTAATTAAATT
ATTTATATATTTTTGAAACCCGAATTGAAAATGTTGCAGGCAACGGGCTACAGCTTTATT
AGTGGTTCTCTAACTGTGGTCTCCTTGGGCCAAGCAATTTCTTTAAAGGAAAAGTTGATT
ATGTATGTGGGGTGCCAGGACCACTGCCTTGAAAGCAAGTGTGATTTTTATTTTTAATAT
TATTTTATTTGTGTCTGTGTACATATTCATGTATAAATTTTATGAAACCCAAGCATAGTG
CTTATTTTTTAATAAAACAACTGACTTAACACATTGTGAAAAAAAAAAAAAAAAAAAA

Protein Sequence

>94234 : length: 403
MKLEVFVPRAAHGDKQGSDLEGAGGSDAPSPLSAAGDDSLGSDGDCAANSPAAGGGARDT
QGDGEQSAGGGPGAEEAIPAAAAAAVVAEGAEAGAAGPGAGGAGSGEGARSKPYTRRPKP
PYSYIALIAMAIRDSAGGRLTLAEINEYLMGKFPFFRGSYTGWRNSVRHNLSLNDCFVKV
LRDPSRPWGKDNYWMLNPNSEYTFADGVFRRRRKRLSHRAPVPAPGLRPEEAPGLPAAPP
PAPAAPASPRMRSPARQEERASPAGKFSSSFAIDSILRKPFRSRRLRDTAPGTTLQWGAA
PCPPLPAFPALLPAAPCRALLPLCAYGAGEPARLGAREAEVPPTAPPLLLAPLPAAAPAK
PLRGPAAGGAHLYCPLRLPAALQAASVRRPGPHLPYPVETLLA