ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

93550

Name

ZFAND4

Synonym

ANUBL1;zinc finger, AN1-type domain 4;ZFAND4;zinc finger, AN1-type domain 4

Definition

AN1, ubiquitin-like, homolog|AN1-type zinc finger and ubiquitin domain-containing protein 1|AN1-type zinc finger and ubiquitin domain-containing protein-like 1|AN1-type zinc finger protein 4

Position

10q11.22

Gene Type

protein-coding

External Links

Links to cell senescence gene database

93550

Links to epithelial mesenchymal transition gene database

93550

Links to ovarian cancer gene database

93550

Links to endometrial cancer gene database

93550

Links to iHOP

93550

Sequence Information

Nucleotide Sequence

>93550 : length: 4616
GGGGCGCGGCGGCAGCGGAGCGTTGTCGGCCAGTGCCTTCCGTGAAGTTGCTCGCCGGGT
CGTTGGGCCCTGTCGACCTGTAGGCGGGCGAGCGAGCCAGCGGACAAGACTGCGGGTGAG
GCTGAGCTAGCGAGCGGCCGGCAGGGGGGGCGCCCGGGCTGCGAGCCGCTGAGCCCAGCC
GCGCTGCCGCCGCCGGCCGTCGTGGGGCCGGAATGGCGCAAGGCCGGAGTGGCGCGGGCG
CTCGGCGCTGGGCTGCCGGGTAGAGTCCTGTCCCCGCCCCTCGCCTTGCGGCCTGACGCC
GGCCGCTGCTGCCCGGGGACCGGAGCGGCGGGCCGCCTTTGCCCAGGACACACGCTCTGG
CGTTTGTTCCTTTGGGCGTGACGCCAGCTTCAACGGGTACGCGGCTTTCCCGACGGGTGC
TGATCTCCGAGTCGCTGTTGTCACGCGGACTGCTGTCCTCCAGATTCAGGCCGGTGGGTC
TGGGGAGCCCGGATTGGTCTTGGAGGAGCAACGGCTGCGCAGGTACAAAACTCAAAACAT
GAACAACAATATATATTACCAATCTTCAAACCTGGTTTGCCTAGAACTGGAATACAGTTG
CCTGCGACATATTTTAGAAGAACTAGAAAAGTCAAAGTAATGGATAACAGAAAAGAGCCT
CCATTCTTCAATGATGATAACATGGGACCATTTTACTACAGACTTCATTTCTGTGATACC
ATGGAGCTCTTCATTGAAACATTAACTGGAACATGTTTTGAGCTGAGAGTTTCACCTTTT
GAAACTGTTATTTCTGTGAAAGCAAAAATTCGAAGATTGGAAGCATTTCAGAAGGGTGTA
CCTTGAAGCTAGTTTTGGCTATGCGTGGCGGACCTATAAATACTAGAAGAGTTCCTACAG
ACGATCCACTTAGGAAGATGGCAGAGTACTTGGATTCCAGTCGAGTTGAGGTCTGGGAGA
AGACCTCCTGCAGCAAACAAGTTACATTTTTGGTATACCAAGAAGGAGATCAATTGAATT
TCTTTCCTGCAGTAGATAGGGGAGATGGCACTTTAACACCGTTATCTGACTCTTCAAAGA
AAATAGATTTTCATTTGCATGTCCTACGGAGAAAAGGAGAACATCGTATGAGTGGTGGTT
CTATGTATAATTCAGATACAGATGAGGATGAAGAAACTGAGCCTTCTTCTTCTGGGCAAC
AGATAATTGAAAATTCAATAACTATGAATAAGATGAAGCTGCTGAAGGCTAAGATGAAGA
ACATGAATCTCAGCAAAAAGCCTAAGAAAGCTGTCAAGATAAAACCTCACCCACCTGTAG
CTCCTCGACCTTCTAGTGGTTCCACTGCACCATCTCGCCACCGATTGTTAAGGGTCCTCC
CCAACATTGGTCAATCTTGTTCACCTGCTTTTGGGAATGCATATCCGCCCGAAATCTCCA
GGAATGGAATTTCAAGTTTGGCAACTCAACTCTCTGCTGAGAGATACATATCTTCTATCA
CTGGTGAATTTCTTAAGGAAGATAATAGCTGGGAGAATAACACACTGTCTCACTTCAGTA
GCAACGTCAAACTACCTCCTCAGATACCCCATTTGGAGTTGGGAAATGACCAGGAGCTTG
CTGACTCTGTTCTCCATCTTGGATCATCCCTGCCTAGGCAAACAAAACATTTTTTAGGAA
ACTTGCCATCTAGTAATGGGAACATTGTCTTACCTTCAGAAGAATGTGTAACCGAACAAT
CACTTCTACCTAAAGTGGGCTCACTGGCTTCATTTGCAGAAGGAAATGCTGATGAACAGA
GCAGCGGCTTAGAAGGTGCGTGCAAAGTGAATCTGGAGTTGCTACTCACTAATGCTGACA
AAGGGTTGAAAGCTCCAGAGCAGCATCTCAAGCATGTTGCAGGAGTGCTGAATGGGGAAT
CAGTAGAGACTTCAGTTCTTAACTACCGGGAATTAAGTCCTCACAAGAATAGACTCTTGT
CACCTCTTCGCTGTTCTGCACCAATGTCGCTACATAATTCTCTGGTGAAACCAGAGAGAC
AGTCCAAATGTTTTGAGTTTGGGAAGCTACAGCCTTCTTCTTCTCAGTCACTGGATGTTC
AAAACATAACTGATTCTTCTTTCTCTAGGACTACTTGCTTTCAAGGTGTTAAAGTTGATT
CACTTGGGAAAAGATCTGATGTTATTTCCAAAGTTGAGGCTCGGGATATCACAGAAATGA
CTAACAAGGCTTCCAAAGAGCCTGTTGGTTGTGTAAATAATATCAGTTTTCTTGCCTCAC
TGGCCGGGAGCACAAGCAGAAATAGATTACAGAGCACACGTGGGGCAGGCAGGCTTCAGA
ACTCTGGAACTGGGCTGTCTACAAACCTCCAGCATTTTCAGGAAGAAAACTTTAGGAAAA
GTTCTCCCCAGTTAGAACATACAGGAGTTTTTTTGTCTACCCATGGTGTTGGAATGAATG
GAAATAATGCAGCAGCAGGGAAAAGCGTAGGAGAATGTACTACTCATCACCTCCCACCTG
TGAAAGCCCCTCTTCAGACAAAGAAGAAAACAACAAATCATTGTTTTCTTTGTGGAAAGA
AAACAGGACTGGCTAGTAGCTACGAATGCAGATGTGGAAACAACTTCTGTGCATCTCATC
GTTATGCAGAAACTCATGGCTGTACCTATGATTACAAGAGTGCAGGGAGGAGATACTTGC
ACGAGGCAAATCCTGTGGTTAATGCACCAAAGCTTCCAAAAATCTAACTCTTCCTCTACA
TCTTACTGTTCTGCCCGGGATTCGTATTATAATGACAGAAGAAATGTTGTTTAGACTATT
ATTTTTGTTCGACTCTAAAAGATTTGCCAAATAACAAAAGCATACAATGCATACTGTTGG
AGAACAAGAATGCTACTGTATTTTACATCTTTATTTCTTGGTGAAACAAAAGTTTTAAAA
GTAGTTTTAACAACTTTACACTGGAATGATTTAGCTTTGTTATTGCATGTCTTGTGTTAA
GTGTTTTGTATATGATATTGCAGTTTTACTAGGCAAATCTTCAAAAGATGCACTTTAGGA
AACGAAATATTTCCTAAATAACCAGGCTTCCACATTGTACAGAATGAGCAGTCATGTAAT
GAATGGCTCTACTCAGATTGACCATATGGGTTTTTTCTTTTTCTTTCTTTTATTCTTCTC
CTTCTTTTTTTTTCAGAGGTGGGATGGGTGGAGATTTTTTAAAAATCCCACGTGTGAAAG
TTTACTGGCTTTATTAGCAAGTTCCTTTTTACTTCAAGCTACTTTTTATAAAAAAGAACA
TTTTTCCAGTGTGGTTTTTAACAGATAATACATTTCTTCCACATTCAGATTAGTATTCGG
ACATGAATCCATTCTATAAAACACATCGTGTTCATGATAGTGTATATTTTACTACTTTTT
GAATGTTAATTTTAAAATAGAAGATGTCCCACTTGCCATTAAATATAGAAGCCAACTTTT
TACCTTTTGAAATATGGCTACATTTAAAACAAAATCTCACAGCTCGGTTTTTCTTATTTG
TTGAGTGCTATTACCAGGAGAAATTCAAATAAATATTCAATTTCATTATGAATTTCATTA
TTTATTTATAATAGTTTTTCTTTTATAAATAATTTTTCTTTTATAAAACTATTTAATTAA
ATGAGTGATTTATTTTACGTGGATAAAATAACTATCAGTATAAAAATATTCTTTTAGGAT
ATTAAGGACCCTGTTCCCCAGGTGTAACCAGAAACCACTAAGGCACTTAGTGGCCACTTG
CTGTATAGAAGCTCAGTTCAGACTGATGCTGAACCCTGGTAAACAACTAGCACCTAACCC
AGGTAGACTCTGCAGCCCTGGGGTAGCAGACTCTGCTAAGAGTACCAGACTCTGCTAAGA
GTACCAGAAGGCTAACTTAGGAGCTGTGAGGGGCCCCTTCCTCTACTTAAGGCTGAATGA
ACTGGAGAGCTCACTGCCCCTGCTCCTGTAAGAAATGAAATGTTGATGGAGACAGATGCC
TTCAGACAAAGAGGGCAGTACATTCATAAGAGGGAATGGCTAAAAGTTAGCAGAGGAGCT
ATGCAAATGGGGGTTGAAGGCATGCTTTTTAAGAAGGGTGGATATAAGTAGATGAAAAAT
ACTTTCATCTGTGTTATGAATAATTCAGTATTTCCTCCTGTATCAAGAAGACACGTGTTT
TAGACACTTAAAATATAAGAACTGCCTTACAGAGTTAGACTGCTGAGAAATGGACCATAG
CATATTTATTCTGCAAACAAATATGAATGCCTAGGGCCTACTTGATGTAGTGTGCTATGC
TTTTTAAACCAAGACTATAAGTAGAAGTAAGTCTCATTCTAAGTTTTACTAAAGATTGTG
GTGAAAGTTAAGTCTTTTTACTAGTTTTCAATAACTGACAGCTGAACTATTTTAATTCAA
CAAGTTATATCATTATATTGAGGGGCATTTCTTTATGCTTTAAATTCTTACACAGACACA
TTCCAAATTTTAGAGACATTGTATCTGTCTTTGCATTTCCAGTAATTAGCAGAGTAGATT
GCCTGTAGGTACTGGTTAAACATTAGTTGAATAAATTGATGCATTGGACAACTTAA

Protein Sequence

>93550 : length: 735
MAASHSGYLYVGENVSKVQNSKHEQQYILPIFKPGLPRTGIQLPATYFRRTRKVKVMDNR
KEPPFFNDDNMGPFYYRLHFCDTMELFIETLTGTCFELRVSPFETVISVKAKIRRLEVPT
DDPLRKMAEYLDSSRVEVWEKTSCSKQVTFLVYQEGDQLNFFPAVDRGDGTLTPLSDSSK
KIDFHLHVLRRKGEHRMSGGSMYNSDTDEDEETEPSSSGQQIIENSITMNKMKLLKAKMK
NMNLSKKPKKAVKIKPHPPVAPRPSSGSTAPSRHRLLRVLPNIGQSCSPAFGNAYPPEIS
RNGISSLATQLSAERYISSITGEFLKEDNSWENNTLSHFSSNVKLPPQIPHLELGNDQEL
ADSVLHLGSSLPRQTKHFLGNLPSSNGNIVLPSEECVTEQSLLPKVGSLASFAEGNADEQ
SSGLEGACKVNLELLLTNADKGLKAPEQHLKHVAGVLNGESVETSVLNYRELSPHKNRLL
SPLRCSAPMSLHNSLVKPERQSKCFEFGKLQPSSSQSLDVQNITDSSFSRTTCFQGVKVD
SLGKRSDVISKVEARDITEMTNKASKEPVGCVNNISFLASLAGSTSRNRLQSTRGAGRLQ
NSGTGLSTNLQHFQEENFRKSSPQLEHTGVFLSTHGVGMNGNNAAAGKSVGECTTHHLPP
VKAPLQTKKKTTNHCFLCGKKTGLASSYECRCGNNFCASHRYAETHGCTYDYKSAGRRYL
HEANPVVNAPKLPKI