ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

93166

Name

PRDM6

Synonym

PR domain containing 6;PRDM6;PR domain containing 6

Definition

PR domain zinc finger protein 6|PR domain-containing protein 6|PR-domain zinc finger protein 6|putative histone-lysine N-methyltransferase PRDM6

Position

5q23.2

Gene Type

protein-coding

External Links

Links to cell senescence gene database

93166

Links to epithelial mesenchymal transition gene database

93166

Links to ovarian cancer gene database

93166

Links to endometrial cancer gene database

93166

Links to iHOP

93166

Sequence Information

Nucleotide Sequence

>93166 : length: 9031
CACACACACACACACACACACACACACACACACACTCACTCTATTTTGTGCTGTCGTAAA
ACCCACGTGTCCAGCCGGGAAGCTGCCAGAGCGTGGAACCAAGGAGCCAGGACGCGGCAG
CGGCCAAGCGCAGCAGCCCACGGCGGTTGAGTCGGGCGCCCAGTTCGAGGCGCCGGACAT
GCTGAAGCCCGGAGACCCCGGCGGTTCGGCCTTCCTCAAAGTGGACCCAGCCTACCTGCA
GCACTGGCAGCAACTCTTCCCTCACGGAGGCGCAGGCCCGCTCAAGGGCAGCGGCGCCGC
GGGTCTCCTGAGCGCGCCGCAGCCTCTTCAGCCGCCGCCGCCGCCCCCGCCCCCGGAGCG
CGCTGAGCCTCCGCCGGACAGCCTGCGCCCGCGGCCCGCCTCTCTCTCCTCCGCCTCGTC
CACGCCGGCTTCCTCTTCCACCTCCGCCTCCTCCGCCTCCTCCTGCGCTGCTGCGGCCGC
TGCCGCCGCGCTGGCTGGTCTCTCGGCCCTGCCGGTGTCGCAGCTGCCGGTGTTCGCGCC
TCTAGCCGCCGCTGCCGTCGCCGCCGAGCCGCTGCCCCCCAAGGAACTGTGCCTCGGCGC
CACCTCCGGCCCCGGGCCCGTCAAGTGCGGTGGTGGTGGCGGCGGCGGCGGGGAGGGTCG
CGGCGCCCCGCGCTTCCGCTGCAGCGCAGAGGAGCTGGACTATTACCTGTATGGCCAGCA
GCGCATGGAGATCATCCCGCTCAACCAGCACACCAGCGACCCCAACAACCGTTGCGACAT
GTGCGCGGACAACCGCAACGGCGAGTGCCCTATGCATGGGCCACTGCACTCGCTGCGCCG
GCTTGTGGGCACCAGCAGCGCTGCGGCCGCCGCGCCCCCGCCGGAGCTGCCGGAGTGGCT
GCGGGACCTGCCTCGCGAGGTGTGCCTCTGCACCAGTACTGTGCCCGGCCTGGCCTACGG
CATCTGCGCGGCGCAGAGGATCCAGCAAGGCACCTGGATTGGACCTTTCCAAGGCGTGCT
TCTGCCCCCAGAGAAGGTGCAGGCAGGCGCCGTGAGGAACACGCAGCATCTCTGGGAGAT
ATATGACCAGGATGGGACACTACAGCACTTTATTGATGGTGGGGAACCTAGTAAGTCGAG
CTGGATGAGGTATATCCGATGTGCAAGGCACTGCGGAGAACAGAATCTAACAGTAGTTCA
GTACAGGTCGAATATATTCTACCGAGCCTGTATAGATATCCCTAGGGGCACCGAGCTTCT
GGTGTGGTACAATGACAGCTATACGTCTTTCTTTGGGATCCCCTTACAATGCATTGCCCA
GGATGAAAACTTAAATGTCCCTTCAACGGTAATGGAAGCCATGTGCAGACAAGACGCCCT
GCAGCCCTTCAACAAAAGCAGCAAACTCGCCCCTACCACCCAGCAGCGCTCCGTTGTTTT
CCCCCAGACTCCGTGCAGCAGGAACTTCTCTCTTCTGGATAAGTCTGGGCCCATTGAATC
AGGATTTAATCAAATCAACGTGAAAAACCAGCGAGTCCTGGCAAGCCCAACTTCCACAAG
CCAGCTCCACTCGGAGTTCAGTGACTGGCATCTTTGGAAATGTGGGCAGTGCTTTAAGAC
TTTCACCCAGCGGATCCTCTTACAGATGCACGTGTGCACGCAGAACCCCGACAGACCCTA
CCAATGCGGCCACTGCTCCCAGTCCTTTTCCCAGCCTTCAGAACTGAGGAACCACGTGGT
CACTCACTCTAGTGACCGGCCTTTCAAGTGCGGCTACTGTGGTCGTGCCTTTGCCGGGGC
CACCACCCTCAACAACCACATCCGAACCCACACTGGAGAAAAGCCCTTCAAGTGCGAGAG
GTGTGAGAGGAGCTTCACGCAGGCCACCCAGCTGAGCCGACACCAGCGGATGCCCAATGA
GTGCAAGCCAATAACTGAGAGCCCAGAATCAATCGAAGTGGATTAACGGATTGACTGGTT
GGAATTAAACTGCAAGGAAAGTCATGATTAAATGTCACGGACACTTAAGCAAAACCAAAG
ATTTCCTCTGAGCAACTTTCAATCAGTCCCAGAAAACCAAAAGCAGTAATAAAATAAGTA
AGATGTTAAGAGATATTGATCCTGGCATGGAAGTCAGACCAGGAAAGAGATTATTTATTT
ATGACTTAGGGATGAGACTTATTTCAGTGGACAACTAACCTGGGATGGTTAACATTTCCA
GTCCCACCATGTATTTTGCTTTGTTTCTAAAAAGCTTTTTAAAAACTGTTATTTAATACC
AAAGGGAGGAATCGTATGGGTTCTTCTGCCCACCGTTGTGACTAAGAATGCACAGGGACT
TGGTTCTCGTTGCACCTTTTTTTAGTAACATGTTTCATGGGGACCCACTGTACAGCCCTT
CATTCTGCTGTGTCAGTTTGGCCTGGCCTGACACTGGCTGCCCCAGCGGGGACCACGGAA
GCAGAGTGAGAGCCTTCGCTGAGTCAATGCTACCTTCAGCCCCAGACGCATCCCATTTCC
ATGTCTTCCATGCTCACTGCTCATGCACTTTTTACACGGTTTCTTCCAAACAGCCCGGTC
TTGATGCAGGAGAGTCTGGAAAAGGAAGAAAATGGTTTCAGTTTCAAAATTCAAAGGAAA
AAGTTGAGGACTTATTTTGTCCTGTCAAGATTGCAAGAACATGTAAAATGTACGGAGCTT
CATAATACGTTATATTGTTCCGAAGCAGCTCGTTGAGAAACATTTGTTTTCAATAACATT
TTAGCTTAAAAAAAAAAAAAGAAAATGAAAATAAAGTTCTTTGGTTTAAGGCTGGAGATA
AGGTGTTAGGCTTCATTGTAATTTTTTTAGTTGTTTCTGTGAAAGTGTTGAACATGTGAA
CAAAAATAGTGCCAAACCCCATCGTCAAGGCCCTTTTAGCAATTTTATCTTTCTTCCTCT
TGCAGATGAACCCCAGGAGCCCCCTTTCCTCTCTCCTGAGTGTGGGAGGAGCATGTCTAC
AAACACAAGTGAAAATAGCCCAGACAAGGAGACTTTGAGAGGAGGAACCATGGAGAAGGT
TGTGGTTAGAACAGATAGCCCAGGAGCAGCTAATTTTATCAATAGGATTACTTTGTCTTT
TCTTGAGATTGATTAATTGAAAGAGAAGGAATTCTCCACACAATTTCACTATTCTTTGAG
TGCTGAGAATGTGAGTTTAATTTCAGCTAGCCTGTTGGTGGTTCAACAGTGGTGCTCAAT
GAAATTGGGTCACATTTAATGAAATGATCTAGTTTTGGGAAGAGCTGATAGCTCCCAGCA
GCATCTCAGCGACTGTCTACCTTGATGGCCAGTTTAGATAAAAACTGTTCAGTTTTATCT
AGAGTGTTTAATAACAACAGTTTCTGTTTGTAAATTTCATCATCACCTGATATCAGGACA
CAGTCTTTTAAGGAACTCCTTGTCTTTGAGCTTTCCCATTGTCTTCCCTCAATAAAAATG
AGACACATAACTGAACTCACTACTAAAAGGCAAGGATACTGTGTGGTTTAGTTTAATCTA
TTATTATGTATCTGGCTCTGAGAAAATCTCTCTTCCCTTTTAATTTTGCTTCTCTATTCC
TTAGCACCCCAGCTACCACATTTTAAATGGAATTCAACAGGGTCTAATTAATAAGTGTTT
ACAGTTATTATTTATATACGTATATATACATATATACACATAATAATAATCTCTAGAACC
CTGGGCCATAAAGAAAAAAATGGCTAATTCTGACCTCTGTTGCCCAATCTCAAGCCATTC
ACCTAGAATTTTCCTCCAGTTCTTACTATCTCCTGGTCATGAAAGTAGTAAGGAATCTAT
GCTGCTGTATAACAGTAGCTGATTGAAACTATTCTCTCTGGTAGTTAGGAATGTGTTCTG
ATTTTACAATTCCCTGCCCTAAGTGATGGATACGTTTGCAAACAATGTGCGTCACTGGGA
AGTGTGAATGAAATGTAGCCATATTAACCTGAAACCTGCAAGAAAAGGACAGATCAGCTT
CACAGATGAGTAAGCTGTTCCATTTGTTAAGGTTGAAAGATTTACTCAAACTTTTTGAAA
ACAACAGTAGGGAATCACCTGTATATTTCTAATTTTTTTTTTCATTTGAAAAATCAGCTC
AGCCATTTGCCACATTTCACAGTGGAACACCATGTACTACTCAGTTCTCATGAGCTTCAG
AACGTGGGAGAATGAGAAGGCTTCCCTCCTCCCTTGATGTCTGGCATGGGAAGGTTTTCC
TTAACAATGATCTCTCTGCCACCCTGATAGCTTTGCTAGCTGATCCCAAACTTCCACTGA
ATGTGGCAGTAACCTGTACTCCAAAACACTCTTCTAGTGTTCTGCTCCATTTAAATCTAT
TTTTATCCTCTATTATTAAGAGAAATTGTTGGCATATATATTCCACCAAATTTGGTCAGA
AAATATTTTCTGCCTAACAAATAGAAAATTGGATACTCTAATTTTCCAGGCATGTGGGCA
CATTCACAATTTTTACATTGCTGTCCTATTGCCAGCTTCTAGCAGACCAGCCTAGGCTGT
CTGTCCACAAAGACAGGCTTACACCTGGACATTGACTTGGAACCCTGAAGCAGGTACTGA
GATCATTTGGGTCCAAAATGATTTTAATCTAAGTGTATGCTGGGGAGGAGGTTTCTCTTT
GAAACTTCCTAACAATTGCTTTAGCCTTTTCTATTTAAAGTGGACACACAGTCCCCTGGG
ATACAGCAAATGGGTGGTAGAAATTGCAGTCGTAAAATTTGCCAGTTTTTCTTATTAGTA
ACTTCCTAATTAGTAGTGCTATAAAGAGAGTAAATGCTCTGAATCACTGGGGAAAGGATA
TTTAAGATAAGAAAGGTAGTCTGTCAGAGCTGAATCAGGGTTTGGCTCTTGAAGCAATCC
TTCTTTACTCTTTTCTTTCAATGGGGATAAAATAATAATAATTTTTTCAGAATAAGACTT
TTCATCCTAGCGTATGTTCCTTTATTTAGCAGAGTCTAAGACGAAAGGTAATGCCAGGGA
AAAGTCAGGGTGCAATAGGATGAGAGATGGAGCTGCAGACCTTTGCATTTCTAGAAAAAT
CTCAATATCCCAAGGCAAAGTTGTATTTTCCCCAGGATATGTGCATACATTTTTCATAGA
TAAGCTTTTCATTTTTGTTTTGTTTTTATCTTTAAAAATGACTTTTTTGGAGGAGATATA
CTTCTAAAAAGTTATTGTATGGCTAATTAAAGCTATGAAACTTAATCTCATATAATTTAT
ATAATTTGATTCAGTTGGTACATTTTTTATTGTGTTCATTTAAATGTAGCCTTCTTGGGA
AACTATGTATAACAGGAAAAGATCATGACATCATTGTGTCCTCATAGGGCTCATAATTGA
ATTTTACCTTGTAAAAATTTCATTCTGGTTCAGGTATGCAAAGATTTATACGAACATTTA
GCAGTTCATCAATTTTTAAATCAGATGTTCATTGTTTCATTCATTTATTCAACAAGTATT
TATTGAACTCTTATTTTATATAAAGACCCCATTTTATGTGTTCACCATAAGCAGCATTAT
TTAAGTGACTATTCATGATAAAATAATATTCTCCTCCTAAGTGGCTGCTAGTAAAATGGG
TATTTTAGTCCTTTAGACCATTGTCTCAGTGAAGTTAAAGATTTTGTTCCAACTGGGAAA
ATCTGAGAGAGGTAAATTCATCTGGGGACCAGAAAATAGCATATTGCAAAACAAGTTAAG
ATGCACAACTTGGTTGTCTTTGCTTAACTCACTGGGCTATTGGTTGTTAGCAGCAGTATC
AAGAGACCAGGATTAGGGCCTGGGTCTTGGGTTTTTATGACCCCCCCTTTCAATGATAAG
GCAACAAGTTGGGTACAAGGCTGGAGTTGCTCAGGGAAGGAGATCTGCGACCCTGAATGG
GTCAGAGTTGCCTCATTAGTGGTAAGCGTTGGCAGTGTAGTCCCTTTCCCCGGTGTGCAG
AAGTAACATTATTTGTTTTGCACTAATTTAAAATTTAAAATGCAAGTATCTATTGAGTTG
TTTAAAATGGGAATCATGGCACGTCTCACAAAGAGGGCATTTCCAGAACAGCAGGGTTAA
CGGGTCCCTCTGAGTGTACCCAGCAGCCTGCGTTTAGGAGCAAATTCATTGCTCTCATAT
TAAGGCTATGCATGCCTACAGAAACCAGGCCAGGAATAAGAAATAAATAATCACATTTCC
TGAAATGTTTATCTGTTTCTTCCTTGACATGAATTTAATTTTTATTTCCCAGAGTCTTTA
CTAGATCCTGACATCAGATTTTAAAAGATACTGAGATATATGCTTCTTTAAATGATAACT
GTAAGTTCCAGAAATGTTATTCACTTGTCAGGATCCTTTTAAGGTGAAGAGCTTTGGAAA
ATTTTATGCGCTAACTAGATACCTGGGTGATCATCAACCCAAAGTTTAAAGTTCTCCCCT
CACTAGCATTTATCTGAACTACCACAAAACAACAACGCAGGTTACTAGGAAGGCACCTAT
TTCAGCCCTCCCCAAGATTGCATTCTACAAACCCAGAGATCAGCTGTCAGGTACAACTGG
CCAGACAGAGCCAAACTGAAAAGAATATTGCTTTATCTGTGGAAACCTTGCCACAGATGT
TTAACCTGTAGTCCATGGCTGTGTTTGACATTTAAAATATTTATTTAGTTTCTTCCTTTA
AATAATAAATGCCAGATGTTTCATCAGATCAATATGTAAAACGATAACAAAAAATATGTC
GGAAACAGGTCAAAGTCATGAAACATTTGAATTGTCTTTCCTATAGACTGAATATGCCAC
CACTGCACTTAGAAAACCTATGGAGGAAATTTTAATGGAAAAATAAGGACATTCTGCGCT
TATTCCCACAGAGGTTGATGGGAATGATGATGATTATAAATTATATTGTGCAATTACTGC
CATGCCTTGTTCTAATGCTTAATGTGGATTATCTCTTTTAATCCTTAGTAACTCTATAAC
AAAGATACTATCATTATCCCCTTCTCATATATGCTTAACAGTTTTAGCTTTGTAGCTTCT
TTAGTTTTTTTCCTCCTTCAAAGCCATAAACAGGCAATTGTTAAAAGAGGAAAATACTTC
TCTATGTAAAGCTTTTTTTTGAGAACAAGAGCTTTTAAAAATTAATAAACACAAGTATAA
TTTATTTATAAAATGTGTTTGTGGAAACAATACTGAAGTGCTATTAAAACACGTATCATT
ATAGATGCTGATTTTGTCATGCCCAAATCTCATTGCTGGACAGAATTTCAACTATTCCAT
TGCTGTCAGGCATTGTTTTTGTTTTTCTAAGCAGGAATCTAAAATTCCACATTGAAAGAA
AAAAAAATAACCCTCTCAAGTGTGATATACATTAGGACAAATGGCAACAGGCAGGAAGGG
CAGGTTGTGTTGGAGGGTGGCCAGAAGAGAATAAGGTTCGAACACTATCGACAGGTAAAA
ACACATCCTCAACGGGGCTAAGTGAAATCTCGTTTTCTTTCTTTGTTCTGACTGAATGCT
AAGTGAGTTACTTTCCAGGCATCAATGGAGTCATTACGCAGTTGTGTGCATTAAGAATAT
GGGCTTATGTTGTTAGCCTGTTGGTTTAAAGCAGTGCAGCAGAAAGACTGGAGTCATTAT
AGGTTTGGTTTGTCAAAGGCACAGATAGTGTAGTTACATGCATGAGGTACTCAAGGAACC
AGTTCAAGTTCTGGGGCACAATCTAGATGAAACTGTGAGGTTTGTTCAAAAAGTAAGTGT
ACAAAATTTCATCATGAACTGGCTTTATTACAACTCTTTACCGTGGTTTATTGAAACCAC
AATGTATACTACTTTCCTCCAGATTCTGATTCTAATGGGCACATTTGTTTGTTGAAATGA
TAAATATATTTTCCTTGTCAAACATGGTGGGTCCTGGTTGATATCTCCTGTTTCCTGCCT
TGAAAAACATCCTTGTTGGTGCCTTTCTCCCACTTTGGTACATCACTCCCAACTGAAAAC
AGTCTAGATATAAACTTTAACAAGCTGGAGATCTATTTCTACAGCACAACTCTTTCATGT
TTAAAAGCAATTATGCCGTATCAGGTGATTGCCACATGTTGGGGAAAGCAGCCATCTTAG
AGCAAAAGTCTGCCAACCCACAGTCCCTGTTGATCCACATGTGGGCATTGTCTAATGTTA
ACAAAATCAGCACTTGTAGACTTACTTTCTCTGAACAATCTAGTACACTTCTCTAGTTTC
TCCCAACCTGGAGAAAATGTATAGCAAAAGCCAGAGGCAAAATTATTCTCCTTAGCAGTT
CTAAGTATTTCATGAAAAAGCCTTCCCCCAGTTTAAATGCAGAGGCTAAGGTGATGACTA
ACGAATTAAGGAAAACTTTGGCTCAGATCAGCAAAATTATTTTGGAAACTTAATGTCCCA
AGTTAATTATTTTTTTTATATCAAGGGGAAGACATCCAGTTCTGTAGGATGCTAATAGAA
GTGTGATATTTAGATGCTATTAGGACATTGTATACATTTCTTTAATGTGGTTATTTTAAG
TTTAGGACTGTAAATGTTCCCTACTGGAATAGAAATATGTCTCTCTCCAACTTTCCACCA
AATAAAATGGTTAGAGTGAATGCCCAGTTTCACATCTGCCTTTTGGAGTTTGGAAAGCTT
AAACAAGTCAGTTAAGAGAATGAGAAGAATCTCACTGTGGGTGATAAGGAGTGTGTAGTT
TGCTGTAAGGGCCACTGATATGACAAGAATGATTATCCCACAGTAAGAATGGGTAAAACT
TAATAAAGTTTTCTAACTTTATTAAACTCACATTATTTAATGAAAAAATAACTGCAAAGG
ACCAATGAGATCATGCATGCTGCTGTATTCTTGTGATGGAATCTACCAGGATTAAGTTGT
ATTTAAATGAAAAAACAGGTACACATTTAGAGATCATTGACCAAGAAATGTAAATATATT
TGATTAATAAAACGTTTTTATGATGACTCGA

Protein Sequence

>93166 : length: 595
MLKPGDPGGSAFLKVDPAYLQHWQQLFPHGGAGPLKGSGAAGLLSAPQPLQPPPPPPPPE
RAEPPPDSLRPRPASLSSASSTPASSSTSASSASSCAAAAAAAALAGLSALPVSQLPVFA
PLAAAAVAAEPLPPKELCLGATSGPGPVKCGGGGGGGGEGRGAPRFRCSAEELDYYLYGQ
QRMEIIPLNQHTSDPNNRCDMCADNRNGECPMHGPLHSLRRLVGTSSAAAAAPPPELPEW
LRDLPREVCLCTSTVPGLAYGICAAQRIQQGTWIGPFQGVLLPPEKVQAGAVRNTQHLWE
IYDQDGTLQHFIDGGEPSKSSWMRYIRCARHCGEQNLTVVQYRSNIFYRACIDIPRGTEL
LVWYNDSYTSFFGIPLQCIAQDENLNVPSTVMEAMCRQDALQPFNKSSKLAPTTQQRSVV
FPQTPCSRNFSLLDKSGPIESGFNQINVKNQRVLASPTSTSQLHSEFSDWHLWKCGQCFK
TFTQRILLQMHVCTQNPDRPYQCGHCSQSFSQPSELRNHVVTHSSDRPFKCGYCGRAFAG
ATTLNNHIRTHTGEKPFKCERCERSFTQATQLSRHQRMPNECKPITESPESIEVD