ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

9314

Name

KLF4

Synonym

EZF|GKLF;Kruppel-like factor 4 (gut);KLF4;Kruppel-like factor 4 (gut)

Definition

Krueppel-like factor 4|endothelial Kruppel-like zinc finger protein|epithelial zinc finger protein EZF|gut-enriched krueppel-like factor

Position

9q31

Gene Type

protein-coding

Pathways and Diseases

Pathway

Synthesis, Secretion, and Deacylation of Ghrelin;PID Reactome;500141

Pathway

Regulation of Wnt-mediated beta catenin signaling and target gene transcription;PID Curated;200106

Disease

Alimentary system disease;FunDO

Disease

Gastrointestinal tumor;FunDO

Disease

Gastrointestinal cancer;FunDO

Disease

Breast cancer;FunDO

External Links

Links to cell senescence gene database

9314

Links to epithelial mesenchymal transition gene database

9314

Links to ovarian cancer gene database

9314

Links to endometrial cancer gene database

9314

Links to iHOP

9314

Sequence Information

Nucleotide Sequence

>9314 : length: 2949
AGTTTCCCGACCAGAGAGAACGAACGTGTCTGCGGGCGCGCGGGGAGCAGAGGCGGTGGC
GGGCGGCGGCGGCACCGGGAGCCGCCGAGTGACCCTCCCCCGCCCCTCTGGCCCCCCACC
CTCCCACCCGCCCGTGGCCCGCGCCCATGGCCGCGCGCGCTCCACACAACTCACCGGAGT
CCGCGCCTTGCGCCGCCGACCAGTTCGCAGCTCCGCGCCACGGCAGCCAGTCTCACCTGG
CGGCACCGCCCGCCCACCGCCCCGGCCACAGCCCCTGCGCCCACGGCAGCACTCGAGGCG
ACCGCGACAGTGGTGGGGGACGCTGCTGAGTGGAAGAGAGCGCAGCCCGGCCACCGGACC
TACTTACTCGCCTTGCTGATTGTCTATTTTTGCGTTTACAACTTTTCTAAGAACTTTTGT
ATACAAAGGAACTTTTTAAAAAAGACGCTTCCAAGTTATATTTAATCCAAAGAAGAAGGA
TCTCGGCCAATTTGGGGTTTTGGGTTTTGGCTTCGTTTCTTCTCTTCGTTGACTTTGGGG
TTCAGGTGCCCCAGCTGCTTCGGGCTGCCGAGGACCTTCTGGGCCCCCACATTAATGAGG
CAGCCACCTGGCGAGTCTGACATGGCTGTCAGCGACGCGCTGCTCCCATCTTTCTCCACG
TTCGCGTCTGGCCCGGCGGGAAGGGAGAAGACACTGCGTCAAGCAGGTGCCCCGAATAAC
CGCTGGCGGGAGGAGCTCTCCCACATGAAGCGACTTCCCCCAGTGCTTCCCGGCCGCCCC
TATGACCTGGCGGCGGCGACCGTGGCCACAGACCTGGAGAGCGGCGGAGCCGGTGCGGCT
TGCGGCGGTAGCAACCTGGCGCCCCTACCTCGGAGAGAGACCGAGGAGTTCAACGATCTC
CTGGACCTGGACTTTATTCTCTCCAATTCGCTGACCCATCCTCCGGAGTCAGTGGCCGCC
ACCGTGTCCTCGTCAGCGTCAGCCTCCTCTTCGTCGTCGCCGTCGAGCAGCGGCCCTGCC
AGCGCGCCCTCCACCTGCAGCTTCACCTATCCGATCCGGGCCGGGAACGACCCGGGCGTG
GCGCCGGGCGGCACGGGCGGAGGCCTCCTCTATGGCAGGGAGTCCGCTCCCCCTCCGACG
GCTCCCTTCAACCTGGCGGACATCAACGACGTGAGCCCCTCGGGCGGCTTCGTGGCCGAG
CTCCTGCGGCCAGAATTGGACCCGGTGTACATTCCGCCGCAGCAGCCGCAGCCGCCAGGT
GGCGGGCTGATGGGCAAGTTCGTGCTGAAGGCGTCGCTGAGCGCCCCTGGCAGCGAGTAC
GGCAGCCCGTCGGTCATCAGCGTCAGCAAAGGCAGCCCTGACGGCAGCCACCCGGTGGTG
GTGGCGCCCTACAACGGCGGGCCGCCGCGCACGTGCCCCAAGATCAAGCAGGAGGCGGTC
TCTTCGTGCACCCACTTGGGCGCTGGACCCCCTCTCAGCAATGGCCACCGGCCGGCTGCA
CACGACTTCCCCCTGGGGCGGCAGCTCCCCAGCAGGACTACCCCGACCCTGGGTCTTGAG
GAAGTGCTGAGCAGCAGGGACTGTCACCCTGCCCTGCCGCTTCCTCCCGGCTTCCATCCC
CACCCGGGGCCCAATTACCCATCCTTCCTGCCCGATCAGATGCAGCCGCAAGTCCCGCCG
CTCCATTACCAAGAGCTCATGCCACCCGGTTCCTGCATGCCAGAGGAGCCCAAGCCAAAG
AGGGGAAGACGATCGTGGCCCCGGAAAAGGACCGCCACCCACACTTGTGATTACGCGGGC
TGCGGCAAAACCTACACAAAGAGTTCCCATCTCAAGGCACACCTGCGAACCCACACAGGT
GAGAAACCTTACCACTGTGACTGGGACGGCTGTGGATGGAAATTCGCCCGCTCAGATGAA
CTGACCAGGCACTACCGTAAACACACGGGGCACCGCCCGTTCCAGTGCCAAAAATGCGAC
CGAGCATTTTCCAGGTCGGACCACCTCGCCTTACACATGAAGAGGCATTTTTAAATCCCA
GACAGTGGATATGACCCACACTGCCAGAAGAGAATTCAGTATTTTTTACTTTTCACACTG
TCTTCCCGATGAGGGAAGGAGCCCAGCCAGAAAGCACTACAATCATGGTCAAGTTCCCAA
CTGAGTCATCTTGTGAGTGGATAATCAGGAAAAATGAGGAATCCAAAAGACAAAAATCAA
AGAACAGATGGGGTCTGTGACTGGATCTTCTATCATTCCAATTCTAAATCCGACTTGAAT
ATTCCTGGACTTACAAAATGCCAAGGGGGTGACTGGAAGTTGTGGATATCAGGGTATAAA
TTATATCCGTGAGTTGGGGGAGGGAAGACCAGAATTCCCTTGAATTGTGTATTGATGCAA
TATAAGCATAAAAGATCACCTTGTATTCTCTTTACCTTCTAAAAGCCATTATTATGATGT
TAGAAGAAGAGGAAGAAATTCAGGTACAGAAAACATGTTTAAATAGCCTAAATGATGGTG
CTTGGTGAGTCTTGGTTCTAAAGGTACCAAACAAGGAAGCCAAAGTTTTCAAACTGCTGC
ATACTTTGACAAGGAAAATCTATATTTGTCTTCCGATCAACATTTATGACCTAAGTCAGG
TAATATACCTGGTTTACTTCTTTAGCATTTTTATGCAGACAGTCTGTTATGCACTGTGGT
TTCAGATGTGCAATAATTTGTACAATGGTTTATTCCCAAGTATGCCTTAAGCAGAACAAA
TGTGTTTTTCTATATAGTTCCTTGCCTTAATAAATATGTAATATAAATTTAAGCAAACGT
CTATTTTGTATATTTGTAAACTACAAAGTAAAATGAACATTTTGTGGAGTTTGTATTTTG
CATACTCAAGGTGAGAATTAAGTTTTAAATAAACCTATAATATTTTATCTGAAAAAAAAA
AAAAAAAAA

Protein Sequence

>9314 : length: 513
MRQPPGESDMAVSDALLPSFSTFASGPAGREKTLRQAGAPNNRWREELSHMKRLPPVLPG
RPYDLAAATVATDLESGGAGAACGGSNLAPLPRRETEEFNDLLDLDFILSNSLTHPPESV
AATVSSSASASSSSSPSSSGPASAPSTCSFTYPIRAGNDPGVAPGGTGGGLLYGRESAPP
PTAPFNLADINDVSPSGGFVAELLRPELDPVYIPPQQPQPPGGGLMGKFVLKASLSAPGS
EYGSPSVISVSKGSPDGSHPVVVAPYNGGPPRTCPKIKQEAVSSCTHLGAGPPLSNGHRP
AAHDFPLGRQLPSRTTPTLGLEEVLSSRDCHPALPLPPGFHPHPGPNYPSFLPDQMQPQV
PPLHYQGQSRGFVARAGEPCVCWPHFGTHGMMLTPPSSPLELMPPGSCMPEEPKPKRGRR
SWPRKRTATHTCDYAGCGKTYTKSSHLKAHLRTHTGEKPYHCDWDGCGWKFARSDELTRH
YRKHTGHRPFQCQKCDRAFSRSDHLALHMKRHF