ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

9271

Name

PIWIL1

Synonym

CT80.1|HIWI|MIWI|PIWI;piwi-like RNA-mediated gene silencing 1;PIWIL1;piwi-like RNA-mediated gene silencing 1

Definition

piwi homolog|piwi-like protein 1

Position

12q24.33

Gene Type

protein-coding

Pathways and Diseases

Pathway

Dorso-ventral axis formation;KEGG PATHWAY;hsa04320

Disease

Stomach cancer;FunDO

Disease

Cancer;FunDO

External Links

Links to cell senescence gene database

9271

Links to epithelial mesenchymal transition gene database

9271

Links to ovarian cancer gene database

9271

Links to endometrial cancer gene database

9271

Links to iHOP

9271

Sequence Information

Nucleotide Sequence

>9271 : length: 3591
TTACTGGGCGTATGGCGTACAGACACGAGGCCGGCGCCCGGGAGGCGGTGTTCATCCGCC
CGGGAAAAGAGCGCCTGTTGCTCGCTGCCCGCGTGTCCCTGGCTCTCTCGGGAACCCAGC
GCCGAAGGCGAGGTGGGCGCGGGCCGAAGGAGGTCCTGGGAGGTCGGCGGCGCGGAGGGA
TCTCCGCGGGAGCCGTTGGGGCTGTTGGCCTCGGGCTGAGGTGCAAGGACCAGGACTAGG
GCGAGGGCAGCGGTCCAAGAAATAGAAAACAATGACTGGGAGAGCCCGAGCCAGAGCCAG
AGGAAGGGCCCGCGGTCAGGAGACAGCGCAGCTGGTGGGCTCCACTGCCAGTCAGCAACC
TGGTTATATTCAGCCTAGGCCTCAGCCGCCACCAGCAGAGGGGGAATTATTTGGCCGTGG
ACGGCAGAGAGGAACAGCAGGAGGAACAGCCAAGTCACAAGGACTCCAGATATCTGCTGG
ATTTCAGGAGTTATCGTTAGCAGAGAGAGGAGGTCGTCGTAGAGATTTTCATGATCTTGG
TGTGAATACAAGGCAGAACCTAGACCATGTTAAAGAATCAAAAACAGGTTCTTCAGGCAT
TATAGTAAGGTTAAGCACTAACCATTTCCGGCTGACATCCCGTCCCCAGTGGGCCTTATA
TCAGTATCACATTGACTATAACCCACTGATGGAAGCCAGAAGACTCCGTTCAGCTCTTCT
TTTTCAACACGAAGATCTAATTGGAAAGTGTCATGCTTTTGATGGAACGATATTATTTTT
ACCTAAAAGACTACAGCAAAAGGTTACTGAAGTTTTTAGTAAGACCCGGAATGGAGAGGA
TGTGAGGATAACGATCACTTTAACAAATGAACTTCCACCTACATCACCAACTTGTTTGCA
GTTCTATAATATTATTTTCAGGAGGCTTTTGAAAATCATGAATTTGCAACAAATTGGACG
AAATTATTATAACCCAAATGACCCAATTGATATTCCAAGTCACAGGTTGGTGATTTGGCC
TGGCTTCACTACTTCCATCCTTCAGTATGAAAACAGCATCATGCTCTGCACTGACGTTAG
CCATAAAGTCCTTCGAAGTGAGACTGTTTTGGATTTCATGTTCAACTTTTATCATCAGAC
AGAAGAACATAAATTTCAAGAACAAGTTTCCAAAGAACTAATAGGTTTAGTTGTTCTTAC
CAAGTATAACAATAAGACATACAGAGTGGATGATATTGACTGGGACCAGAATCCCAAGAG
CACCTTTAAGAAAGCCGACGGCTCTGAAGTCAGCTTCTTAGAATACTACAGGAAGCAATA
CAACCAAGAGATCACCGACTTGAAGCAGCCTGTCTTGGTCAGCCAGCCCAAGAGAAGGCG
GGGCCCTGGGGGGACACTGCCAGGGCCTGCCATGCTCATTCCTGAGCTCTGCTATCTTAC
AGGTCTAACTGATAAAATGCGTAATGATTTTAACGTGATGAAAGACTTAGCCGTTCATAC
AAGACTAACTCCAGAGCAAAGGCAGCGTGAAGTGGGACGACTCATTGATTACATTCATAA
AAACGATAATGTTCAAAGGGAGCTTCGAGACTGGGGTTTGAGCTTTGATTCCAACTTACT
GTCCTTCTCAGGAAGAATTTTGCAAACAGAAAAGATTCACCAAGGTGGAAAAACATTTGA
TTACAATCCACAATTTGCAGATTGGTCCAAAGAAACAAGAGGTGCACCATTAATTAGTGT
TAAGCCACTAGATAACTGGCTGTTGATCTATACGCGAAGAAATTATGAAGCAGCCAATTC
ATTGATACAAAATCTATTTAAAGTTACACCAGCCATGGGCATGCAAATGAGAAAAGCAAT
AATGATTGAAGTGGATGACAGAACTGAAGCCTACTTAAGAGTCTTACAGCAAAAGGTCAC
AGCAGACACCCAGATAGTTGTCTGTCTGTTGTCAAGTAATCGGAAGGACAAATACGATGC
TATTAAAAAATACCTGTGTACAGATTGCCCTACCCCAAGTCAGTGTGTGGTGGCCCGAAC
CTTAGGCAAACAGCAAACTGTCATGGCCATTGCTACAAAGATTGCCCTACAGATGAACTG
CAAGATGGGAGGAGAGCTCTGGAGGGTGGACATCCCCCTGAAGCTCGTGATGATCGTTGG
CATCGATTGTTACCATGACATGACAGCTGGGCGGAGGTCAATCGCAGGATTTGTTGCCAG
CATCAATGAAGGGATGACCCGCTGGTTCTCACGCTGCATATTTCAGGATAGAGGACAGGA
GCTGGTAGATGGGCTCAAAGTCTGCCTGCAAGCGGCTCTGAGGGCTTGGAATAGCTGCAA
TGAGTACATGCCCAGCCGGATCATCGTGTACCGCGATGGCGTAGGAGACGGCCAGCTGAA
AACACTGGTGAACTACGAAGTGCCACAGTTTTTGGATTGTCTAAAATCCATTGGTAGAGG
TTACAACCCTAGACTAACGGTAATTGTGGTGAAGAAAAGAGTGAACACCAGATTTTTTGC
TCAGTCTGGAGGAAGACTTCAGAATCCACTTCCTGGAACAGTTATTGATGTAGAGGTTAC
CAGACCAGAATGGTATGACTTTTTTATCGTGAGCCAGGCTGTGAGAAGTGGTAGTGTTTC
TCCCACACATTACAATGTCATCTATGACAACAGCGGCCTGAAGCCAGACCACATACAGCG
CTTGACCTACAAGCTGTGCCACATCTATTACAACTGGCCAGGTGTCATTCGTGTTCCTGC
TCCTTGCCAGTACGCCCACAAGCTGGCTTTTCTTGTTGGCCAGAGTATTCACAGAGAGCC
AAATCTGTCACTGTCAAACCGCCTTTACTACCTCTAACCTGCAGAAGACGATGCAGCCGC
TTTTCTTTTTGAAATGACTTTGGGATTTTTTTAAGCTTTTATTTACTTTTTTTTTAACTG
TTATCTTTCTGGATGAAACTTGGGAAGGGGATTAGGAGATCTAGCATTTTATTTCTAGCA
TTGCTATTCACCGGCTTCCTTATTTTATACGTAAAAATTAAGATTTTATATTTTATCTTC
TTGTTTCTCATAGATATTTTGTGAGCATTTTTTTGTTTATTTTGAAGAAATGTGGATAAG
ATACTTGGTAGTATAAAACAGACTCTCTGAGAGTATTTGAAATGTGTTTGGAGATTTACT
TAAACGTACTTTCAGGAGTGAGCAAGTCCTACTTATAAACCTATATTAACTTTATTTTTG
AGATACCTGTTTTGAATTTAAAGGAGATAAGAGGCGTAAAGTAGGATGCTCACTACAACC
ATAGGTGGGGTTTCAGCTCATATCTTAAAGATAAAAGGTACTATTATATAACCTATACAC
AAGATACAGGAGAAAATATGCTTGATTTTTATTTGGCAGGGGGGCTAGGTTGTATGGGAG
TAAAAAAAACATTGAAAATTTTTAAATTGTCCAAAGAAACATTTTAAGACTCTTTAACAA
AAAAGGCCATGAGTAAATCTCTATATTAACATTACTATTTATTTTGTTTTGGAACTGGGA
CATGATTCTATTTGTTATAAAATAAAATTGATGTGATTGTCACCTTATTTG

Protein Sequence

>9271 : length: 861
MTGRARARARGRARGQETAQLVGSTASQQPGYIQPRPQPPPAEGELFGRGRQRGTAGGTA
KSQGLQISAGFQELSLAERGGRRRDFHDLGVNTRQNLDHVKESKTGSSGIIVRLSTNHFR
LTSRPQWALYQYHIDYNPLMEARRLRSALLFQHEDLIGKCHAFDGTILFLPKRLQQKVTE
VFSKTRNGEDVRITITLTNELPPTSPTCLQFYNIIFRRLLKIMNLQQIGRNYYNPNDPID
IPSHRLVIWPGFTTSILQYENSIMLCTDVSHKVLRSETVLDFMFNFYHQTEEHKFQEQVS
KELIGLVVLTKYNNKTYRVDDIDWDQNPKSTFKKADGSEVSFLEYYRKQYNQEITDLKQP
VLVSQPKRRRGPGGTLPGPAMLIPELCYLTGLTDKMRNDFNVMKDLAVHTRLTPEQRQRE
VGRLIDYIHKNDNVQRELRDWGLSFDSNLLSFSGRILQTEKIHQGGKTFDYNPQFADWSK
ETRGAPLISVKPLDNWLLIYTRRNYEAANSLIQNLFKVTPAMGMQMRKAIMIEVDDRTEA
YLRVLQQKVTADTQIVVCLLSSNRKDKYDAIKKYLCTDCPTPSQCVVARTLGKQQTVMAI
ATKIALQMNCKMGGELWRVDIPLKLVMIVGIDCYHDMTAGRRSIAGFVASINEGMTRWFS
RCIFQDRGQELVDGLKVCLQAALRAWNSCNEYMPSRIIVYRDGVGDGQLKTLVNYEVPQF
LDCLKSIGRGYNPRLTVIVVKKRVNTRFFAQSGGRLQNPLPGTVIDVEVTRPEWYDFFIV
SQAVRSGSVSPTHYNVIYDNSGLKPDHIQRLTYKLCHIYYNWPGVIRVPAPCQYAHKLAF
LVGQSIHREPNLSLSNRLYYL