ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

9258

Name

MFHAS1

Synonym

LRRC65|MASL1;malignant fibrous histiocytoma amplified sequence 1;MFHAS1;malignant fibrous histiocytoma amplified sequence 1

Definition

MFH-amplified sequences with leucine-rich tandem repeats 1|leucine rich repeat containing 65|malignant fibrous histiocytoma-amplified sequence 1|malignant fibrous histiocytoma-amplified sequence with leucine-rich tandem repeats 1|malignant fibrous histioc

Position

8p23.1

Gene Type

protein-coding

External Links

Links to cell senescence gene database

9258

Links to epithelial mesenchymal transition gene database

9258

Links to ovarian cancer gene database

9258

Links to endometrial cancer gene database

9258

Links to iHOP

9258

Sequence Information

Nucleotide Sequence

>9258 : length: 6474
GCGGCGCCCGCGCTCCCGCCCGAGCCCGGGGAAACGGAGACAAGGAGGCGCCGCCGCCCC
CTCCCCGCGGCTGCGCCCCAGCCCTGCGCCCGCAGCATGCCCGCCGCCGGGCCGAGCGCC
GCCCTCCCCCAGGAGCTCGAGGAGGCGACGCCGCTGCCGGCCGCGGGACCGCGGCTGCGA
GGGTAGCGGGGCCGGAGCCGGGCCCCCCGAGGCGCCGCGCGGCGGGCGGAGAGGGAGGAG
GAGCAGGCATCCTCCGCGGCGCGCGGGCGGCGGCCCTGCTGCCCGGCGCGCCCATGGCCC
GGCCGCAGGGAGAATGCAAGCTGCTCTCCACGCGCTCGGCGTCCCCCGGAGCCGCTCGCG
TCGCCGCCGCCCCCTAGCCGCCAGCGCTCGGCCGCTGGCTGCGCTAGGACCCGCGGCCGC
CGGCCGCCGAGCGCGGGAGGGCAGGCAGGGGCAGGAGCCGGAGGGCCCGGGGCGCGGCGC
GGCATGTAGCTGCGGGCTCCCGCGTCCGCGTGAGGCTGTCGGCCCGGGGCCCCGCCATGG
CTGGGATGGACAGTGGCAACCTGAAGACCGCGAGGCTGTGGCGGGACGCCGCCCTGCGTG
CCAGGAAGCTGCGGAGCAACCTGCGCCAGCTCACGCTTACCGCCGCCGGGGCCTGCCCCG
GGGCCGGGGCCGACGCGCTCGAGTCCCCCGCCTCCCCCCAGCTCGTGCTGCCGGCCAACC
TCGGGGACATTGAGGCACTGAACCTGGGGAACAACGGCCTGGAGGAGGTACCCGAGGGGC
TGGGGTCGGCGCTGGGCAGCCTGCGCGTCCTGGTCCTGCGCAGGAACCGCTTCGCCCGGC
TGCCCCCGGCGGTGGCCGAGCTCGGCCACCACCTCACCGAGCTGGACGTGAGCCACAACC
GGCTGACCGCCCTGGGCGCGGAGGTGGTGAGTGCTCTGAGGGAGCTGCGGAAGCTCAACC
TCAGCCACAACCAGCTGCCCGCCCTGCCCGCCCAGCTGGGCGCTCTCGCTCACCTGGAGG
AGCTGGATGTCAGCTTTAACCGGCTGGCGCACCTGCCTGACTCCCTCTCCTGCCTCTCCC
GCCTGCGCACCCTGGACGTGGATCACAACCAGCTCACTGCCTTCCCCCGGCAGCTGCTGC
AGCTGGTGGCCCTGGAGGAGCTGGACGTGTCCAGCAACCGGCTGCGGGGCCTGCCTGAGG
ATATCAGTGCCCTGCGTGCCCTCAAGATCCTCTGGCTGAGTGGGGCCGAGCTTGGCACGC
TGCCCGCCGGCTTCTGCGAGCTGGCCAGTTTGGAGAGCCTCATGCTAGACAACAACGGGC
TGCAGGCTCTGCCCGCCCAGTTCAGCTGCCTGCAGCGGCTCAAAATGCTCAACCTCTCCT
CCAACCTCTTCGAGGAGTTCCCTGCCGCGCTGCTGCCCCTGGCTGGTCTGGAGGAGCTCT
ACCTTAGTCGCAACCAGCTCACCTCGGTGCCATCCCTTATCTCGGGCCTGGGCCGGCTTC
TCACCTTGTGGCTGGATAATAACCGCATCCGCTACCTGCCGGACTCCATCGTGGAGCTGA
CCGGCCTGGAGGAGCTCGTGCTGCAGGGGAACCAGATCGCGGTGCTGCCCGACCACTTTG
GCCAGCTCTCCCGGGTGGGTTTGTGGAAGATCAAAGACAACCCACTGATCCAGCCCCCCT
ACGAGGTCTGCATGAAGGGGATCCCCTACATCGCAGCCTACCAGAAGGAACTGGCTCATT
CCCAGCCGGCGGTGCAGCCCCGGCTCAAGCTGCTCCTGATGGGGCATAAGGCTGCAGGAA
AGACTTTGCTGCGCCACTGCCTCACCGAGGAGAGAGTGGAGGGATGCCCAGGAGGAGGGG
ACAAGGAGAAGTGCTACCCACCGTCACCTCCCCCTGTGAGCAAGGGCATCGAGGTGACCA
GCTGGACGGCCGATGCCTCCCGGGGCCTGCGGTTCATCGTGTATGACTTAGCTGGGGATG
AAAGTTATGAGGTGATCCAGCCCTTCTTCCTGTCCCCAGGGGCCCTATACGTGCTGGTGG
TCAACTTGGCCACCTATGAGCCTCGCCACTTTCCTACCACCGTGGGCTCCTTCTTGCATC
GGGTCGGGGCGAGAGTGCCCCACGCGGTGGTGTGCATCGTGGGCACCCACGCAGACCTGT
GCGGAGAGCGTGAGCTGGAGGAGAAATGTCTGGACATTCACCGCCAGATCGCCCTGCAGG
AGAAGCACGACGCGGAGGGACTGAGCCGCTTGGCCAAGGTGGTGGACGAGGCACTGGCCC
GGGACTTCGAGCTGCGCTCTGCCAGCCCCCACGCAGCCTACTATGGCGTTTCGGACAAGA
ACCTTCGACGGCGCAAGGCCCATTTTCAATACCTGCTCAACCACCGGCTGCAGATCCTCT
CCCCCGTGTTGCCTGTTAGCTGCAGGGACCCGCGCCACTTACGACGCCTTCGGGACAAGT
TGCTGTCAGTTGCTGAGCACCGAGAGATCTTCCCCAACTTACACAGAGTACTGCCTCGAT
CCTGGCAGGTGCTGGAGGAACTGCATTTCCAGCCACCTCAGGCCCAGCGACTGTGGCTAA
GCTGGTGGGACTCGGCGCGCTTGGGCCTGCAGGCGGGTCTGACCGAGGACCGACTGCAGA
GTGCCCTCTCCTACCTGCATGAGAGCGGCAAGCTACTCTACTTTGAGGACAGTCCGGCTC
TCAAGGAGCACGTCTTCCACAACCTCACCCGCCTCATCGACATCCTCAATGTCTTCTTCC
AGAGGGATCCCTCTTTGCTGCTGCATAAGCTGCTCCTAGGGACCAGTGGAGAGGGCAAGG
CGGAGGGGGAAAGCTCCCCGCCCATGGCGCGGTCCACCCCCAGCCAGGAACTGCTCCGGG
CCACCCAGCTCCATCAGTATGTGGAGGGCTTTCTGTTGCATGGGCTCTTGCCAGCTCATG
TCATTCGGTTGCTGCTTAAGCCTCATGTCCAGGCCCAGCAGGACTTGCAGCTGTTGCTGG
AGCTGCTGGAGAAGATGGGACTCTGTTACTGCCTCAATAAACCCAAGGGCAAGCCTTTGA
ATGGGTCCACAGCTTGGTACAAGTTCCCATGCTATGTGCAGAACGAGGTGCCCCATGCAG
AAGCCTGGATTAATGGGACCAACCTAGCTGGGCAGTCTTTTGTGGCTGAGCAGTTGCAGA
TTGAATATAGCTTTCCTTTTACTTTTCCACTTGGGTTGTTTGCACGCTACAGTGTCCAGA
TCAACAGCCATGTGGTGCACAGGTCGGATGGTAAATTTCAGATCTTTGCCTATAGAGGGA
AAGTTCCTGTGGTTGTGAGTTACAGACCTGCCAGGGGAGTCCTGCAGCCAGACACCCTGT
CCATTGCTAGCCATGCATCATTACCAAATATATGGACCGCATGGCAAGCCATAACCCCCT
TGGTGGAGGAACTGAATGTCCTACTTCAGGAATGGCCTGGACTGCACTACACCGTGCACA
TTCTCTGTTCTAAGTGCCTTAAGAGAGGATCGCCCAATCCACATGCTTTTCCAGGGGAGT
TGCTGAGTCAGCCCAGACCGGAAGGAGTGGCAGAGATCATTTGCCCCAAGAACGGCAGCG
AGCGAGTAAATGTTGCCTTGGTTTACCCACCCACGCCGACTGTGATCAGCCCCTGTTCCA
AGTATCTTCATACTTTCTTGGAAAATTAAGTGGAAAAGATAGTGCTTCTTTTCCTTATGC
CATCATTTTTACTGTACCCAAACTGTGACTTTAGGAGCACCAATTTTTAAGGGAAGAATG
TTGGTGAAAAGCACAGAAACCAGTGACGTTTGTGGCTGTGGAATTTCCATGGAGAAAAGA
GAGCATCTGAACACCTGGACCATCTTTTGCACCTGGCAGACCCTCTGCACTCACCCCAGC
GTGTTCTGTGAACTTGAGTGACAACGCGTGCTTGCAGGGTGCTTTTTGGACGACTGGGGA
AGAGGTGGGGAGGGGGTGGTGGGGGGAAGCATGGACGAGAACATGGAGCAAATGTTTTAC
AACCTGAACCTCAGAACTGTGATCCTCCAAGGAGCGCGCTACTTGAAGAAAAGAAAAAAA
AAAAAAAAAAGTCGAATGGCTTCTCAGGGATTTTGTTTTCCGTGCACATATAAGCCATAG
TTACAGTACAGGTGGCAGTATTTAGAGCACTCAGATTTCAGTTCTGTTAAATGTGAAAGA
GGGATCGACTGACGTTCATTGCTGTTCCATAACTAGTGTAAAATATGTATATGTTTATCT
TTATTTTTATAATATGCAAATACATTTAAATTTATACAGTTTGAAGCTTCTAGCGTTAGT
TCACACTGGGTGCAATATTCTGCATGAGAACTGTGCCAAGATGGGGCTGATTTCTTATTT
TAGTATAAGACTTTTTTGTTTTTTCTTTATTCTTTAATCCTCTTCACATTAAAAAAAAAA
TCTCTCTGTTAGCCCATGGATTAAGTGTTGGTTCATAGAGATTGCCAATAATCAGAAAGA
ACCTTAAATGTGCATTTAAGACAGTGTCCCTTCCCTTCTTTTCAATGAAGGTCCCTGCCT
ATATAAATCATCTGGCACGCTGGTGGGAAATCCTTTGCTCTTCCAACGTGTTATTAGTGC
TGGGCAGAGATGGGGCACACTCAGGGGCCAAAGAGGACAAAAAGTCCATGCAAAACTTGA
GTCTTTTAATGGCTTAAGATAATCAGGAGTCAGTTCTGAATCTTACAAAGTGCTCTGCTT
AATAAGTACCTTACTTAGCAGAGCACTTTGCAAACATATTACTTATTAGCAGAGCTCTTT
GTAGACCTTCCACATCTGGCTGTCAGATCTTAAGGTTGTGAATTTAGGCTCCAGTTACAT
TCACTGGAGAGCATAATCCCACACGGGTTATTTATAAATACAGAGCCTCTGATTGGACGG
TCTCCTGCCAAGAACTAGTAATACCCTTGTTTTAAAATCTTCACAAGGTAAAACTTAAAA
AGCCAACCAAACAAATTGCTCTCCATTCTACTTTTAATTGGGCCAAACAGCATATGCTAC
AGTAGTAACATGTTTTTCGGAGAGTGTAAAAAACTCTGTTTACATTTGCCTCCTCCGTGG
GTTGATCGAAAATGTATAAAACTGACTGCTTCTCGCCAGCCTCAGACAAGAAGAGTGAGT
TGCTGGTACTCGCTACTCTTTTACTTCTTTTGTAAAGTATTGACTCTTGGAAGGCTACAG
TATACAAAGTCTCAACATGTTTTTTAAAAGAAATAAGGAGCAAGCGACTGCCCTGCTAGA
AATCACAAACCGATTTTTGTAGAATATTTTGTGCCCCAGGCATTAATTTCACTGACTCCA
GAACCTGCAGTTCAGAGAATGATTTCTTATGATGATAAAAATCGAATGGGATCAGACGAT
GTTTGCATTTTTTTAATACTTGAATAGGACACCTCAAGTTTGAGATTTCATTTTCTTTTA
GAACACAGTCACAAGATTAATCTGGTGAATCCTTTTGTCACAGTTCTCGTGTGTGTGTGC
GCGTCTCCGTGTGTGTGTGTGTGCATGTGTGTAAAACTGAATGGTCACATTTAATTGCTT
TTTGGACCATTGAATAGTTGGGAAGTAAGAATTTTTTAATTGGCATGAGACGGTTCCTCA
ACTGTTAAATTAACCAACTTTGACCTGTCTTTAGAAAAAGGCTTATTTGTATGATTTTGG
GCTAACTCCCCGGGGACCATATTAAATGACAAAAATGCTCCTTTGGGTGACACACCCTAC
AAAGTATTTGCTGTTACGAACATAAACGCCCACATTCTTAATATCTAATATTTTTGACCA
GTGATGTTTTATGCTGTCATCTGAACCCTAGAGAAGCAGTGTCAGAGGAAACCTTGGTGT
CACATGTGTCTTAGCAAAAGGGTTACCATGATCGAGGGTCATGTGACCAAAAGATGCTCC
AGAGAAGCTTGAGAATTTGTTTCAAGTTGGGAGGAGGGTTGGAGATACAAAAATCACTCT
GCTCTACAGGACTCTTCAGCTGTCTATGCAAGAAATTCCGTTTTCTCTTTCAGCACCTGG
AAAGACACAGCAGCCCACCGAGGCGATAGGTGATTCACTAAGCACAAGAGGAATGTTTTC
TAAGCAAGGCGTCCCTTGCCTCTCAAACAAATGCCCTCCAAGTTTGTTAGGGTTTCTATT
CCTGCAACTTGTGGTATCAAAACCACTTCCTGGAATTGTCAAAGCACTGCCAAAATAAAT
GTTTTTCCCCCTTCTAAGAAAAAAAAAATGACAGTGCTCATATTTGACACTTGTGTATTG
GACTCTCTTTTGAATGAATAAAAAGGAAAAGGGGTTTGGTGTAATTCCTGATGGGGTGCG
TGTTGTTTTTCATGCCATGGTTTGTGAATTTTAATTGTGGTTTCCCATTTCGTTGTTGTA
ACTGGGCAGAAATTAAAAAAGAAAAATCAATAAAAATACAAAGAAATGGTTAAA

Protein Sequence

>9258 : length: 1052
MAGMDSGNLKTARLWRDAALRARKLRSNLRQLTLTAAGACPGAGADALESPASPQLVLPA
NLGDIEALNLGNNGLEEVPEGLGSALGSLRVLVLRRNRFARLPPAVAELGHHLTELDVSH
NRLTALGAEVVSALRELRKLNLSHNQLPALPAQLGALAHLEELDVSFNRLAHLPDSLSCL
SRLRTLDVDHNQLTAFPRQLLQLVALEELDVSSNRLRGLPEDISALRALKILWLSGAELG
TLPAGFCELASLESLMLDNNGLQALPAQFSCLQRLKMLNLSSNLFEEFPAALLPLAGLEE
LYLSRNQLTSVPSLISGLGRLLTLWLDNNRIRYLPDSIVELTGLEELVLQGNQIAVLPDH
FGQLSRVGLWKIKDNPLIQPPYEVCMKGIPYIAAYQKELAHSQPAVQPRLKLLLMGHKAA
GKTLLRHCLTEERVEGCPGGGDKEKCYPPSPPPVSKGIEVTSWTADASRGLRFIVYDLAG
DESYEVIQPFFLSPGALYVLVVNLATYEPRHFPTTVGSFLHRVGARVPHAVVCIVGTHAD
LCGERELEEKCLDIHRQIALQEKHDAEGLSRLAKVVDEALARDFELRSASPHAAYYGVSD
KNLRRRKAHFQYLLNHRLQILSPVLPVSCRDPRHLRRLRDKLLSVAEHREIFPNLHRVLP
RSWQVLEELHFQPPQAQRLWLSWWDSARLGLQAGLTEDRLQSALSYLHESGKLLYFEDSP
ALKEHVFHNLTRLIDILNVFFQRDPSLLLHKLLLGTSGEGKAEGESSPPMARSTPSQELL
RATQLHQYVEGFLLHGLLPAHVIRLLLKPHVQAQQDLQLLLELLEKMGLCYCLNKPKGKP
LNGSTAWYKFPCYVQNEVPHAEAWINGTNLAGQSFVAEQLQIEYSFPFTFPLGLFARYSV
QINSHVVHRSDGKFQIFAYRGKVPVVVSYRPARGVLQPDTLSIASHASLPNIWTAWQAIT
PLVEELNVLLQEWPGLHYTVHILCSKCLKRGSPNPHAFPGELLSQPRPEGVAEIICPKNG
SERVNVALVYPPTPTVISPCSKKNVGEKHRNQ