ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

9232

Name

PTTG1

Synonym

EAP1|HPTTG|PTTG|TUTR1;pituitary tumor-transforming 1;PTTG1;pituitary tumor-transforming 1

Definition

ESP1-associated protein 1|pituitary tumor-transforming gene 1 protein|securin|tumor-transforming protein 1

Position

5q35.1

Gene Type

protein-coding

Pathways and Diseases

Pathway

Cell cycle;KEGG PATHWAY;hsa04110

Pathway

Cell Cycle, Mitotic;Reactome;REACT:152

Pathway

Oocyte meiosis;KEGG PATHWAY;hsa04114

Pathway

APC/C:Cdc20 mediated degradation of Securin;PID Reactome;500398

Disease

Cancer;FunDO

External Links

Links to cell senescence gene database

9232

Links to epithelial mesenchymal transition gene database

9232

Links to ovarian cancer gene database

9232

Links to endometrial cancer gene database

9232

Links to iHOP

9232

Sequence Information

Nucleotide Sequence

>9232 : length: 1093
CGCGGGTGGTTAGTTGAGCCGGCTCCGGCGGGGAAGGAGGCGGGCTGCGGCTGCGGCTGG
GGCTGAAGCTGGGGCTGGGGTTGGGGGACTGCCCGGGGCTTAGATGGCTCCGAGCCCGTT
TGAGCGTGGTCTCGGACTGCTAACTGGACCAACGGCAACTGTCTGATGAGTGCCAGCCCC
AAACCGCGCGCTGCTCGGGACCTTAGAGCCTCTGACTCAGGCTGGAAGATTTGAGAGCTG
GATTAAGTACTTGTTGGCTCACGCCCGTGACTGTTCCGCTGTTTAGCTCTTGTTTTTTGT
GTGGACACTCCTAGGATAGAAAGTTTGGTATGTTGCTATACCTTTGCTTCTCCCACCTTC
CCCAATATCTAATATGTATTTCTCATTCTTAGAATAATCCAGAATGGCTACTCTGATCTA
TGTTGATAAGGAAAATGGAGAACCAGGCACCCGTGTGGTTGCTAAGGATGGGCTGAAGCT
GGGGTCTGGACCTTCAATCAAAGCCTTAGATGGGAGATCTCAAGTTTCAACACCACGTTT
TGGCAAAACGTTCGATGCCCCACCAGCCTTACCTAAAGCTACTAGAAAGGCTTTGGGAAC
TGTCAACAGAGCTACAGAAAAGTCTGTAAAGACCAAGGGACCCCTCAAACAAAAACAGCC
AAGCTTTTCTGCCAAAAAGATGACTGAGAAGACTGTTAAAGCAAAAAGCTCTGTTCCTGC
CTCAGATGATGCCTATCCAGAAATAGAAAAATTCTTTCCCTTCAATCCTCTAGACTTTGA
GAGTTTTGACCTGCCTGAAGAGCACCAGATTGCGCACCTCCCCTTGAGTGGAGTGCCTCT
CATGATCCTTGACGAGGAGAGAGAGCTTGAAAAGCTGTTTCAGCTGGGCCCCCCTTCACC
TGTGAAGATGCCCTCTCCACCATGGGAATCCAATCTGTTGCAGTCTCCTTCAAGCATTCT
GTCGACCCTGGATGTTGAATTGCCACCTGTTTGCTGTGACATAGATATTTAAATTTCTTA
GTGCTTCAGAGTTTGTGTGTATTTGTATTAATAAAGCATTCTTTAACAGATTCTTAAAAA
AAAAAAAAAAAAA

Protein Sequence

>9232 : length: 202
MATLIYVDKENGEPGTRVVAKDGLKLGSGPSIKALDGRSQVSTPRFGKTFDAPPALPKAT
RKALGTVNRATEKSVKTKGPLKQKQPSFSAKKMTEKTVKAKSSVPASDDAYPEIEKFFPF
NPLDFESFDLPEEHQIAHLPLSGVPLMILDEERELEKLFQLGPPSPVKMPSPPWESNLLQ
SPSSILSTLDVELPPVCCDIDI