ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

92140

Name

MTDH

Synonym

3D3|AEG-1|AEG1|LYRIC|LYRIC/3D3;metadherin;MTDH;metadherin

Definition

3D3/LYRIC|astrocyte elevated gene 1|astrocyte elevated gene-1 protein|lysine-rich CEACAM1 co-isolated protein|metastasis adhesion protein|protein LYRIC

Position

8q22.1

Gene Type

protein-coding

Pathways and Diseases

Pathway

Validated targets of C-MYC transcriptional activation;PID Curated;200045

Disease

Migraine;NHGRI

External Links

Links to cell senescence gene database

92140

Links to epithelial mesenchymal transition gene database

92140

Links to ovarian cancer gene database

92140

Links to endometrial cancer gene database

92140

Links to iHOP

92140

Sequence Information

Nucleotide Sequence

>92140 : length: 7667
GGCCCAAGCCGCCATTGTTCCGCCGAGGGAGGACAGCGGGGCCTGGCGCTGGCGCCGAGA
CGCCGCTTAGCGGCCGCCACTGGAGACACTCCCTCCCGCCTCCCGGGTCTCCTGGCGGCG
GCGGAGTGAGGCTGACAGCGGGGAACCTGGGAGACCCCTCCGCCCTCCCCGCGGTGGCAG
CGGCCGATCCCCGGCTCCGGCGCGAGGGACGGCCGCGATGCGCTCGGCCTGAGGTTACCC
GGCCCGGCCCTTCCTCGCTTCCCTCGACTATTCCACTGCGTCTCCGCGCCCCGGCGTCAT
CCTGCGAGTCCCTCTGACGGGAGGGAAGATGGCTGCACGGAGCTGGCAGGACGAGCTGGC
CCAGCAGGCCGAGGAGGGCTCGGCCCGGCTGCGGGAAATGCTCTCGGTCGGCCTAGGCTT
TCTGCGCACCGAGCTGGGCCTCGACCTGGGGCTGGAGCCGAAACGGTACCCCGGCTGGGT
GATCCTGGTGGGCACTGGCGCGCTCGGGCTGCTGCTGCTGTTTCTGCTGGGCTACGGCTG
GGCCGCGGCTTGCGCCGGCGCCCGCAAAAAGCGGAGGAGCCCGCCCCGCAAGCGGGAGGA
GGCGGCGGCCGTGCCGGCCGCGGCCCCCGACGACCTGGCCTTGCTGAAGAATCTCCGGAG
CGAGGAACAGAAGAAGAAGAACCGGAAGAAACTGTCCGAGAAGCCCAAACCAAATGGGCG
GACTGTTGAAGTGGCTGAGGGTGAAGCTGTTCGAACACCTCAAAGTGTAACAGCAAAGCA
GCCACCAGAGATTGACAAGAAAAATGAAAAGTCAAAGAAAAATAAGAAGAAATCAAAGTC
AGATGCTAAAGCAGTGCAAAACAGTTCACGCCATGATGGAAAGGAAGTTGATGAAGGAGC
CTGGGAAACTAAAATTAGTCACAGAGAGAAACGACAGCAGCGTAAACGTGATAAGGTGCT
GACTGATTCTGGTTCATTGGATTCAACTATCCCTGGGATAGAAAATACCATCACAGTTAC
CACCGAGCAACTTACAACCGCATCATTTCCTGTTGGTTCCAAGAAGAATAAAGGTGATTC
TCATCTAAATGTTCAAGTTAGCAACTTTAAATCTGGAAAAGGAGATTCTACACTTCAGGT
TTCTTCAGGATTGAATGAAAACCTCACTGTCAATGGAGGAGGCTGGAATGAAAAGTCTGT
AAAACTCTCCTCACAGATCAGTGCAGGTGAGGAGAAGTGGAACTCCGTTTCACCTGCTTC
TGCAGGAAAGAGGAAAACTGAGCCATCTGCCTGGAGTCAAGACACTGGAGATGCTAATAC
AAATGGAAAAGACTGGGGAAGGAGTTGGAGTGACCGTTCAATATTTTCTGGCATTGGGTC
TACTGCTGAGCCAGTTTCTCAGTCTACCACTTCTGATTATCAGTGGGATGTTAGCCGTAA
TCAACCCTATATCGATGATGAATGGTCTGGGTTAAATGGTCTGTCTTCTGCTGATCCCAA
CTCTGATTGGAATGCACCAGCAGAAGAGTGGGGCAATTGGGTAGACGAAGAAAGAGCTTC
ACTTCTAAAGTCCCAGGAACCAATTCCTGATGATCAAAAGGTCTCAGATGATGATAAAGA
AAAGGGAGAGGGAGCTCTTCCAACTGGGAAATCCAAAAAGAAAAAAAAGAAAAAGAAGAA
GCAAGGTGAAGATAACTCTACTGCACAGGACACAGAAGAATTAGAAAAAGAGATTAGAGA
AGACCTTCCAGTGAATACCTCTAAAACCCGTCCAAAACAGGAAAAAGCTTTTTCCTTGAA
GACCATAAGCACTAGTGATCCAGCCGAAGTACTCGTCAAAAATAGCCAGCCTATCAAGAC
TCTTCCACCTGCTACTTCTACCGAGCCATCTGTAATCTTATCAAAAAGTGATTCTGACAA
GAGCTCTTCCCAAGTGCCGCCAATACTACAAGAGACAGATAAATCCAAGTCAAATACCAA
GCAAAATAGTGTGCCTCCTTCACAGACCAAGTCTGAAACTAGCTGGGAATCTCCCAAACA
AATAAAAAAGAAGAAAAAAGCCAGACGAGAAACGTGAAATTTTTTTTCCTGAATTGGACA
TGTGTTTGCAAACACTTGTCTTGAAGATTATGCTGTTTATGCAATAATTTGTGAACATGT
ACAGAGTTTTATATAAATTTAAACCAATTTTTAAAACAAAACTGCGGACACCACCATAAA
AATGGAATCAAAAGAAAGTTAATTTATGAAATTAAGAGGTCAGCAGAATATACTCAGTGA
TGGAAGACACTTGGGAAAGTCTTTTTAATAGAACAAGAACGATCTTAATTTAAGAATATT
ATCCTGGTTTAACAACAGTGCCCTGTTTACAACAGATTGTGCCCTATCTCATCTGCAGCC
GAGGAATAAAGGATTCTGATTAGAAAGAGGGTTGCCTACAGATTAGTAAGCAATTCCTTG
GATCTTATGCACAGAACTTGTACCATTTGAATCTGTTTTATGCTTAAATCAAAGTGCTTT
GATCAAATGCATAACCTGCCATATCTTTACATATTTGTTGGTAGCAATTTGTATTAAAGA
AATCACAAGTGCAAATAAAAAGTCATTTATCATTTGTTTAACTAAACTGTCATGGTTTAG
TTTACAATTTTTAAAAAGTTCTTAAAATACTGAAAATGCAGTTGACACTTGTGTATGGCT
TATGAAGTTATTTTTGATAGTCTTACATTACTTGAATTGTTCAAAGTACAGTATATTTTA
AATTAAGAAAAGTGAACTATATGTATTTGTTTTATACATTTAAGGCTTAGACTCATAAAT
AATGCTATTGTTTATGATTTGAAAACTTTCAGGCAAAATCCAATTTACATTTTTCCCTTC
CCTAGCAATTACTTTTTTCCAGCTTCAACTCTTCTTAGTTACTAATACTTTGTTGACTTT
AAAAATGAAATCATTCACAAACTTTTGGTATATGATGGAGAATGAAAAACTAGAGTCAGA
CAGCTTTAATTGACATTGTCAACACCTCCAGTTATCAGGAATACATTTTTTTACTGCCTT
AACCTGTAGTGCGTAGAATATGCATCAATTTCTTGAAGGAGATTCATGTTTTTATAAGAA
TTTTCATGTAATTATTGCAATTGTGGTCAAATAAGGAACGTTTCCTGCTTGAAATTATAT
TGATTTAAATGATGTGTGAGATGTTTCACCATTTTCAGGCACTGTGTAATTCTATTGTAA
TAAACTGGCAGGTATCTTTGTAACTATAAATAGTGCATGCTCAGCCATGTACACTGTAAA
TAGCCTTTACCAAACGTGTTTGACAAGGACCATAATTAACATCACTTAGTGAATTGTGAT
AAAGAAAAAAAAGCCATGATTTATTCGATGTGATTGGCTTGTTTTTATGTGGCGCCAAGA
ACGAACCTGTTTAACAGCTGTAACCAATGGTACTGATCTATCCATCCAATGTTGTCATTA
TATTTGACTGTGGTTCAACAGTATTGCGTTGTCAGACTAGGAAAGCTAAACGAACAAAAT
GGTTTTAGTTTTGCTGAAGACTGGCCTTATTAATGGACAGCTTTCCTAACAAGAGATTAT
TAACTTTTATCAGGTGTTAACATCTGTTTCAGGAACATGGCAGTATGTTTACATGTCAGA
AGTTTTGTTTAATTCTATGGTATTTCTAAATTGACTTGTTTAAATAAATTCAGCAAATGG
ATAGCATTGTTTTTTATTTGCTTCAATATGGGGGTAGATAATAGCTAAAGAGCCAAGGAT
GAATTTCTTCAAATGACTTTATTCTGTTAGCTTTACATAGGTGTTGGAGGATTCCTAAGG
TGTCAGCATTTTGTAAAGGTACCACAAAGGAGAAGTTGATAGGGAATCTAATTTTAGAAT
GTGCCAAATGGTCTGTGCTCAACAATATAATTGAACTCTCTCAACTCTACCTCACCATTT
CTTTATCTCAAAATTCTGTTGGCTTTGTCAAACGTTGGATTTTATTTCTGCAGCCTAGTA
TCTCCCCATTCTACCACCTATGCCAGATGTTAAAGACAGCAGATGTTTTGAGGAGAATGG
CATTGTGGAGATGCAGAGATGCGTTGCTAAGTTGAGGTGGATCCAGTATAGAGATACCTC
TATTTCTTCTTTATGGCTCAAGAGCTAGGACTTGGATTTTGTTTTAAGAGATGGCAGCTG
GCCGGGTGCAGTGGCTCACGTCTGTAATCCCAGCACTTTGGGAGGCCGAGGCAGGTGGAT
CACGAGGTCAGGAGTTCAAGACCAGCCTGGCCAAGAGGGTGAAACCCCATCTTTACTAAA
AATACAAAAAAAAAAATTAGCTGGGTGTGGTGGTGGGCTCCTGTAATCCCAGCTACTCAG
GAGGCTAAGGCAGAGAATCATTTGAACCCAGGAGACGGAGTTTGCAAAGCCAAGATCGTG
CCACTGCACTCCAGCCTGGGCAACAGAAGGAGACTCCGTCTCAAAAAAAAAAAAAAGATG
GCAGCTATATAAATGATAAAATTAATTACATTCTCTTTCACATGCATGAGGTGCAAACTC
TGTCACAAAGTATTTTAATTACCTTTTACCTTGTTTCATAGATCTTTATGTGACATAAAA
ACAGTTTCTGGCACGGTGGCTCACGCCTGTAATCCTAGCACTTTGGGAGGCTGAGGCAGG
TGGATCACCTGAGGTCAGGAGTTTGAGACCAGCCTGGCCAATATGGTGAAACCCCATCTC
TACAAAATTTGCAAAAAGTAGATGGGTGTGGTAGTGGGCGCCTGTAATCCCAGCTACTCA
GGAGGTTGAGGCAGAGAATCGCTTGAACCCGGGGGGTGGAGGTTGCAGTGAGCTGAGATC
GCACCACTGCACTCCAGCATGAAAGAGCGAGACTCAATCTCAAAAAAAAAAAAGTTTCTG
GCACCTGAACAGGAACTGGTTTCCATCATCAACTCAGAAAGCACTAAAATCTAGGTGGTG
ATTCAGGGAGGAGCAGGGGAAGACAGCCTCCTATGGTGGCATGAATAAGATGCTTCCAGA
ACTAGTAGGGAAATAACTAACCTCTTCAGGCTTTATCAGGCCTGGAGGGGAACCTTGCTC
ATGTTAGCAAGAAAGGTATCCTAGAGAAGCCACTCAAAAGGCTCCCTAATCCAGCCTGTC
TCCACATACATACTGAAAATTCTTCCCTACTCTGAGGCAGGGTGTAGTGGTTTAGGGGTT
TCTCCAGACTGGAATCCTACCTATCTGTACCGACAATTGAGCAAACAACAGTTGAGAGAG
TCCAAAAAAAAAAGTATTAAAATGTGATTGATGTAATTTACCATGTTTACTTTATGCATG
CATTTTATTGGGGAGGGGAGGTCAGAATAATTCACCCAAATCTAGTGGTCTTATTTCATA
GGCTAATCTGGTTTATATTTGCATTAAAGATACTGGAGGGCAATATTTACAGAGTTTAGT
TTTTCTTAATTAAAAACAGTCCTCTATTAATATAGTGTGAAATATCTTTCAAAATTTAGA
GTTTAGGTTTAAGATGTCTACTAGATATCTTTAAGATTTTCCTGTAAACTCACTGCACAA
ACTGGAATTACTTTCCAAAAGACTTAGGGAATGCAAATATGTTACTCATAAGATGCATTG
AGTATTGTAAATAAAACAAACCATTTTTGATTTGTTTAAATTGCTCGTTACAGTTCTCTT
GTGGGGAGGGACTTTGTCAGTCATTTTGCATCTTAAGCTAGACTAAACTTTTTGTTGTTG
TTTTCCTAAAACCATAGGTGCAAGCTTTGCCGCTGGGAAGTCATATTGAATTAAGCACTT
TTGAAAATGTCACTGTTTGTGACACACAATGTTCTCTACAGAAAACTTCTTCTATCTTAT
GTCATTTTAGCAGTAGATGTAGCTGCCTGCCACCAGGTGCAATATGTCATTTGCATCAGC
CTTTTCAGTTAAGGAAATTAAAACTTGGCATGCATTAGTTCATATGTATGAGGTTGGCTG
TGTCCCCAAACAGCAATTGCTTGTACAAGATAGAAGTTTGCTTCTCAGCTGGGCATGGTG
GCTCATGCCTGTAATCCAAGCTCTTTGGGAGGCCAACGCGGGAGGATTGTTTGAGCCCAG
GAGTTTGAAACCATCCTGAGCAATAGAGAGACCCCCATCTCGACAAAAAAAAAAAAAAAA
AATTAGAAACAAAAAAAAGATTGTTTCTCTTTCATATTAAAGTTTGGGAAGGCAATCCAG
AGCCCATATGACATTATGCAGGGTCAGGGATCCGGGTTCTTTCTATATTGTTCCTCCCCA
TTCTCAACCTGTAGCTTTTTTTTTTTTTCTTTTAATGAGATAGGGTCTCACTCTGTTGCC
CAGGCTGGAGTGCAGTGGCACACTTCTGGCTCACTTCAGCCTGGAACTCCCGGGCTCGAG
CTATATTCTCCCACTTTAGCCTCAGCCTCCAGAGTACCTGGGACTACAGGTACACACCAC
CATGCCTGGCTAAATTTTTTTTTTTTTTTTTTGGTAGAGATGAGGTCATTGCTATGTTGC
CCAGGCTGGCCTTGAAGTCCAGGGCTTAAGTGATCCTCCTGCCTTGGCCTCCCAAAGTGC
TGGTGTTACAGGTGTGAGCCACCACACCTGGCCAACATGTGGCTTTCAGTTCTTACTTGA
AGACAGCTGCTCTAGCTAGAAACTTCCTATCGGCATCTGAGCCAGCTGGTAGAGGGCATT
ACCTCCCCCACCCCCAAGAACACTTCTTGGAAGTTACACACAATACATAAACTTCAATTT
CAAACAGTTGCTTGGTCCCACTAGCCATGAAGCTGGATGGGACGTAATATTCTATCTGGG
TTGTCATGGGCCAAATTAACATTTTGAGATTCTGTTAGGAAGATGAGAATTGGATAATGG
GCACCTCTAACAGTGTCTGTCAGAGTTGACATACATTGTGTATCTCCTGCACCAAAGCAT
TTTTGAGATCAAGTGTTCTTCCAGCTGAGCAGAAATTTGGAAGGCTATTCAGTGCTGCTT
AGTGTAGCAGCTAATAATGTTCCAACTTCTATATGATAGTTTGCTTTTTGTTTTTTGTTT
TTTTCTAGAGACAGAGTCTCGTTGCCCAGGCTGGTCTCCAATTCCTGGGTTCAAGCAATC
CTCCTGACTCAGCCTCCTAAATGCTGGGATTACAGGCATGAACCACTGTGCCCAGTCTAT
ATATAATAGATTTTAGAAGAAATTTCTGCCACTCAGTGACTGCTTTAAATTCTAGAGACA
GAGGCTGAGAGAAACTTAGTAGCCTGCCTGCGCATACTGCAAGTACAGACTATATAACAA
GTTGAAAGAGAATCACCCTGGTATATAATATTTTAAAACATGAAAAAGGCATTACTATTG
TTCTGGTCTAAGTACTCTAACAGGACGATGATTTCTAACCCTAGCATCATGACATGTATA
TAGTGTGTTGTAAGACATTTGCCAGCTAATAGTTACAGTACTGAAGCTTGTGAATACGTT
AATTGAGAAAACTTTAAGCAGGTTCAAAGTTATCCCATGATAGTGGCATTCTTATTTGTA
TATATGTGCTTTCCTTTTTTATTTGTATCAAGGCATTTAAAATGAATATATGTAACATGT
ACCTAAGTTTTAAAAGCATAATAAAATGAACACATCTGAAACCACCA

Protein Sequence

>92140 : length: 612
MAARSWQDELAQQAEEGSARLREMLSVGLGFLRTELGLDLGLEPKRYPGWVILVGTGALG
LLLLFLLGYGWAAACAGARKKRRSPPRKREEAAAVPAAAPDDLALLKNLRSEEQKKKNRK
KLSEKPKPNGRTVEVAEGEAVRTPQSVTAKQPPEIDKKNEKSKKNKKKSKSDAKAVQNSS
RHDGKEVDEGAWETKISHREKRQQRKRDKVLTDSGSLDSTIPGIENTITVTTEQLTTASF
PVGSKKNKGDSHLNVQVSNFKSGKGDSTLQVSSGLNENLTVNGGGWNEKSVKLSSQISAG
EEKWNSVSPASAGKRKTEPSAWSQDTGDANTNGKDWGRSWSDRSIFSGIAAWSSVDRGMN
TSEQNSASFASLTLNSAVSGSTAEPVSQSTTSDYQWDVSRNQPYIDDEWSGLNGLSSADP
NSDWNAPAEEWGNWVDEERASLLKSQEPIPDDQKVSDDDKEKGEGALPTGKSKKKKKKKK
KQGEDNSTAQDTEELEKEIREDLPVNTSKTRPKQEKAFSLKTISTSDPAEVLVKNSQPIK
TLPPATSTEPSVILSKSDSDKSSSQVPPILQETDKSKSNTKQNSVPPSQTKSETSWESPK
QIKKKKKARRET