ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

92105

Name

INTS4

Synonym

INT4|MST093;integrator complex subunit 4;INTS4;integrator complex subunit 4

Definition

MSTP093

Position

11q14.1

Gene Type

protein-coding

External Links

Links to cell senescence gene database

92105

Links to epithelial mesenchymal transition gene database

92105

Links to ovarian cancer gene database

92105

Links to endometrial cancer gene database

92105

Links to iHOP

92105

Sequence Information

Nucleotide Sequence

>92105 : length: 3301
GCGGGTAGGCATGGCGGCGCACCTTAAGAAGCGGGTTTATGAGGAATTCACGAAAGTGGT
TCAGCCACAGGAGGAAATTGCTACTAAGAAACTCCGACTAACAAAACCAAGTAAATCTGC
AGCACTCCACATAGATCTGTGTAAAGCTACCTCCCCAGCAGATGCTTTGCAATACTTGCT
CCAGTTTGCCAGGAAGCCTGTCGAGGCGGAAAGCGTAGAGGGAGTAGTCAGGATTCTCTT
GGAACATTATTACAAGAGATGGAGTCTCTCTGTGTTGCCCAGGCTGGTCGCGAATTCCTG
AGCTCAAGCAACCCTCCTGCTTGGCCCTCCCAAAGGATTGGGATTACAGACGTGAGCTAC
CACATCTGACCAAAATCAGGATTTCTGTTCTCAAGAAGTTTTCGATCTCTCAGTGATCTA
TTTTCCGAGAATGATCCATCTGTGAGACTGAAAATTGCATCATTGTTGGGTTTATTATCA
AAGACAGCAGGATTTTCACCAGACTGCATTATGGATGATGCCATCAACATCCTGCAGAAT
GAAAAGTCTCATCAAGTCCTAGCTCAACTGCTGGATACTTTGCTTGCAATTGGCACTAAG
CTACCAGAGAATCAAGCTATCCAAATGCGATTAGTTGATGTGGCCTGCAAGCATCTGACA
GATACGTCTCATGGTGTAAGAAATAAGTGCCTGCAGTTACTTGGCAATCTTGGCTCTTTG
GAGAAAAGTGTCACAAAAGATGCAGAAGGCCTAGCTGCCAGAGATGTCCAGAAGATTATA
GGGGATTACTTCAGTGACCAAGACCCACGTGTCAGAACAGCAGCTATAAAAGCCATGTTG
CAGCTCCATGAAAGAGGACTGAAATTACACCAAACAATTTATAATCAGGCCTGTAAATTA
CTCTCTGATGACTATGAACAAGTGCGCAGTGCTGCAGTCCAGCTTATCTGGGTCGTCAGT
CAGCTCTATCCTGAAAGCATTGTCCCAATTCCTTCTTCTAATGAAGAAATACGCTTAGTT
GATGATGCGTTTGGCAAAATTTGTCACATGGTCAGTGATGGCTCTTGGGTGGTTCGTGTT
CAGGCAGCAAAACTGTTGGGCTCTATGGAGCAAGTCAGTTCTCATTTCTTGGAGCAGACC
CTTGACAAGAAGCTGATGTCAGATCTGAGGAGGAAACGTACTGCACATGAGCGTGCCAAG
GAACTTTACAGTTCGGGGGAGTTTTCCAGTGGCAGAAAGTGGGGAGATGATGCTCCCAAG
GAAGAAGTAGATACCGGGGCTGTGAACTTGATTGAGTCAGGAGCTTGTGGAGCTTTTGTT
CATGGGTTGGAAGATGAGATGTATGAGGTTCGTATTGCTGCTGTGGAGGCCCTCTGCATG
TTGGCCCAGTCTTCACCCTCTTTTGCTGAGAAGTGCCTTGATTTCCTAGTTGACATGTTC
AACGATGAAATTGAGGAAGTACGTCTGCAGTCTATACATACCATGAGAAAAATCTCTAAC
AACATCACCCTCCGAGAAGATCAGCTTGACACTGTCCTGGCTGTGCTAGAGGATTCATCC
AGAGATATTCGAGAGGCTCTTCATGAACTCTTATGCTGTACTAATGTTTCAACCAAAGAA
GGGATTCATCTTGCATTGGTGGAGCTGCTGAAAAATTTAACCAAGTACCCTACTGATAGG
GACTCCATATGGAAGTGCTTGAAGTTTCTGGGAAGTCGGCATCCAACCCTGGTGCTTCCC
TTGGTGCCAGAGCTTCTGAGCACCCACCCATTTTTTGACACAGCTGAACCAGACATGGAT
GATCCAGCTTATATTGCAGTTTTGGTACTTATTTTCAATGCTGCTAAAACCTGTCCAACA
ATGCCAGCATTGTTCTCAGATCACACCTTCAGGCACTATGCCTACCTCCGAGACAGTCTT
TCTCATCTTGTTCCTGCCTTGAGGTTACCAGGTAGAAAACTGGTGTCATCAGCTGTTTCT
CCCAGCATCATACCTCAAGAGGATCCTTCCCAGCAGTTCCTGCAGCAGAGCCTTGAAAGA
GTGTATAGTCTTCAGCACTTGGACCCTCAGGGAGCCCAGGAGCTGCTGGAATTCACCATC
AGGGATCTGCAAAGACTTGGAGAACTTCAATCTGAATTGGCAGGAGTAGCTGATTTCTCT
GCCACCTATCTTCGCTGTCAACTACTTCTCATCAAGGCCTTGCAGGAAAAGTTGTGGAAT
GTAGCTGCCCCTTTGTATTTGAAGCAGAGTGATTTGGCCTCAGCAGCAGCGAAACAGATT
ATGGAAGAGACCTACAAAATGGAATTCATGTACAGTGGTGTGGAGAATAAGCAGGTGGTG
ATTATACATCACATGAGGCTGCAGGCCAAAGCTTTGCAACTTATAGTAACAGCACGAACT
ACACGAGGACTTGACCCCTTATTTGGGATGTGTGAAAAATTTTTACAGGAAGTAGACTTT
TTTCAGAGGTATTTCATCGCTGATTTGCCCCACTTGCAGGACAGCTTTGTGGACAAACTC
CTTGACCTTATGCCCCGACTCATGACATCCAAACCTGCAGAAGTGGTCAAAATTCTACAG
ACCATGCTGCGACAGAGTGCCTTTCTGCATCTCCCGCTTCCAGAGCAGATCCACAAAGCC
TCAGCCACCATCATCGAGCCAGCGGGCGAGTCAGACAACCCTTTGCGGTTTACCTCTGGG
TTGGTGGTTGCCCTGGATGTTGATGCAACCCTGGAGCATGTGCAGGATCCTCAGAACACT
GTTAAGGTCCAGGTCTTATATCCAGATGGCCAGGCTCAGATGATTCACCCCAAGCCTGCA
GACTTCCGGAATCCTGGCCCAGGGCGGCACCGGCTCATCACTCAGGTTTATCTCTCCCAC
ACCGCTTGGACAGAGGCATGCCAGGTGGAAGTGAGGCTGCTGCTGGCCTACAACTCCAGT
GCTCGCATTCCAAAATGCCCCTGGATGGAGGGTGGTGAGATGTCACCACAGGTGGAAACC
AGCATCGAGGGCACCATTCCCTTCAGCAAGCCTGTAAAAGTTTATATAATGCCCAAACCT
GCACGGCGCTAAGGCAAAAACAGTCTTCCCAACCGTGGCCTAGAGGGCCCTTCTTAGGTG
TCAGAATGAGCCAAGCCTGAAGCACTTCACCTGGAATTGATGTGTAGGCTTAAGGAGTAT
GTGACCCTTACAGTCTCATCTGGTATCAAACACAGGATAAATTGTTTCTTCATTAAAAAA
TAAAAAACCTTCAAGTCTACTTACCCTTCTCCTGTCCACAATAAAGTTGAGAAAACACCA
A

Protein Sequence

>92105 : length: 963
MAAHLKKRVYEEFTKVVQPQEEIATKKLRLTKPSKSAALHIDLCKATSPADALQYLLQFA
RKPVEAESVEGVVRILLEHYYKENDPSVRLKIASLLGLLSKTAGFSPDCIMDDAINILQN
EKSHQVLAQLLDTLLAIGTKLPENQAIQMRLVDVACKHLTDTSHGVRNKCLQLLGNLGSL
EKSVTKDAEGLAARDVQKIIGDYFSDQDPRVRTAAIKAMLQLHERGLKLHQTIYNQACKL
LSDDYEQVRSAAVQLIWVVSQLYPESIVPIPSSNEEIRLVDDAFGKICHMVSDGSWVVRV
QAAKLLGSMEQVSSHFLEQTLDKKLMSDLRRKRTAHERAKELYSSGEFSSGRKWGDDAPK
EEVDTGAVNLIESGACGAFVHGLEDEMYEVRIAAVEALCMLAQSSPSFAEKCLDFLVDMF
NDEIEEVRLQSIHTMRKISNNITLREDQLDTVLAVLEDSSRDIREALHELLCCTNVSTKE
GIHLALVELLKNLTKYPTDRDSIWKCLKFLGSRHPTLVLPLVPELLSTHPFFDTAEPDMD
DPAYIAVLVLIFNAAKTCPTMPALFSDHTFRHYAYLRDSLSHLVPALRLPGRKLVSSAVS
PSIIPQEDPSQQFLQQSLERVYSLQHLDPQGAQELLEFTIRDLQRLGELQSELAGVADFS
ATYLRCQLLLIKALQEKLWNVAAPLYLKQSDLASAAAKQIMEETYKMEFMYSGVENKQVV
IIHHMRLQAKALQLIVTARTTRGLDPLFGMCEKFLQEVDFFQRYFIADLPHLQDSFVDKL
LDLMPRLMTSKPAEVVKILQTMLRQSAFLHLPLPEQIHKASATIIEPAGESDNPLRFTSG
LVVALDVDATLEHVQDPQNTVKVQVLYPDGQAQMIHPKPADFRNPGPGRHRLITQVYLSH
TAWTEACQVEVRLLLAYNSSARIPKCPWMEGGEMSPQVETSIEGTIPFSKPVKVYIMPKP
ARR