ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

9181

Name

ARHGEF2

Synonym

GEF|GEF-H1|GEFH1|LFP40|P40;Rho/Rac guanine nucleotide exchange factor (GEF) 2;ARHGEF2;Rho/Rac guanine nucleotide exchange factor (GEF) 2

Definition

Rho/Rac guanine nucleotide exchange factor 2|guanine nucleotide exchange factor H1|microtubule-regulated Rho-GEF|proliferating cell nucleolar antigen p40|rho guanine nucleotide exchange factor 2

Position

1q21-q22

Gene Type

protein-coding

Pathways and Diseases

Pathway

Pathogenic Escherichia coli infection;KEGG PATHWAY;hsa05130

Pathway

Regulation of RhoA activity;PID Curated;200050

Pathway

Signaling by Rho GTPases;Reactome;REACT:11044

Pathway

Signaling by GPCR;Reactome;REACT:14797

Pathway

Reelin signaling pathway;PID Curated;200051

Pathway

Regulation of RAC1 activity;PID Curated;200165

Pathway

Signalling by NGF;Reactome;REACT:11061

Disease

Embryoma;FunDO

Disease

Cancer;FunDO

External Links

Links to cell senescence gene database

9181

Links to epithelial mesenchymal transition gene database

9181

Links to ovarian cancer gene database

9181

Links to endometrial cancer gene database

9181

Links to iHOP

9181

Sequence Information

Nucleotide Sequence

>9181 : length: 5591
TACCCCTGAAATGGGAGGGACACATTTCGTCAAGTTAAATGGGCTAAAGAAGGTGATGGC
TATTTTTAGATCCTGGTAGAAATGTTTGTTTCTGTGTATCTAAAAAATTATTTCTGAAAA
TCTGGAAGATATCACTGGATAGGAGTAGAGGGGGCGCTGGAATGAAGAAGGGTCTTGGAA
AAGGGGGGCAGGTGACACCAAGGAGAAGGGAAAAGTGTTCATTGTTCAAGAGGATATAGA
AAACGGAAACTGAGTCAAGCTGCAGGCCAAGCTCACTAAACACAGGTGTTTTTAAAGGCA
GAACACTTTTCTTTTCCCTGTCCCTAGTCCCTTTCCTTGTTATTCATCTCCTAAGGGGAA
GAAGAGGGCATAGGGTGAGGGGTAGGGTAACAGCAGGTGGGATGGAAAGTAGACTGAAGG
TTGGGGTGGGAGACAGAAAAGAGTTGGAGGGTCGGGTCCTCTTCTTTCATAGAGACCTTC
TTAGTTGAGTTGAGGGACCATGAGGTCGCTTGAAAAACCCCAGGGTTCAAATTCTATGTT
TCCTGGGTACCCAGGCTGGAGTGTGGCCCTTTAAGATTCTATCCATAGCTTGCAGCACCC
TCCTGCCCCAGGCCTGGGAGAGAAGCTGAGGTCCCACCCCAGATCTTGTCTCTGGGCCTC
CAGTGGGTGGAACCTTGAGGCCAAGATTCTAGCCTCTGGCTGTCTGTTTTTAAATTTAGT
ACATTCCTGAGTCTTGGCTGCCCACCTCAGGGGAGGTGAGTCTGGAGTTCTGGGGCCAGG
AGCCTCAGGCCTCTTGGTTTGGGGGAGTTCCTACACCCTCCCCGTAGGTATACTTGGCAG
GTGCAAGCCAGGAAGAACAAGCTGTGGCCCTGGGGAAGTCCTTCCTGCTTTCTAATGTCC
ATCCAGCCTGAACTGGGCACGGTTTATTTCCTCTTCCTTTTTCCTGGTCTTTGCTATTTA
AGGATTCTAAACAGGGGAATGGGTGAAGAAGGAGGTGAAGGAGTTGCTAGGAAGGAGGGG
AAGCCGGAGGGGCAGTGTGGGGGTAGTGCTGGGGGTGAGGAGCCCAACCAGCTCAGCCAG
TGGTGAGGTAGTGGAGCCCAAAAATAGTGGCAGAGGCTAAAATTGGCACCTACAAGAGTG
CTGAGTTGGGCTTGAAACCTGCAGCCTGGCCCCACTGCTGAGCCAGGGCAGAGAACTGCT
GGATCTGGGTTGGGTCTCCCCTCCCTCCCTTCTTCTCCCACGCCCTTTGGGGCCAGAATC
AGGCAGGACCCTGCTAACCGAAGGCTCTGTCCCAGGCCTCTCTGTGCTTCTGGTTTCTCC
AGAGAAATGGGAGACCCTGAGAGGCAGAAATGAACTTCACTACCCGGGAAAAGGAGAAGA
TGAAGGAAGCCAAGGATGCCCGCTATACCAATGGGCACCTCTTCACCACCATTTCAGTTT
CAGGCATGACCATGTGCTATGCCTGTAACAAGAGCATCACAGCCAAGGAAGCCCTCATCT
GCCCAACCTGCAATGTGACTATCCACAACCGCTGTAAAGACACCCTCGCCAACTGTACCA
AGGTCAAGCAGAAGCAACAGAAAGCGGCCCTGCTGAAGAACAACACCGCCTTGCAGTCCG
TTTCTCTTCGAAGTAAGACAACCATCCGGGAGCGGCCAAGCTCGGCCATCTACCCCTCCG
ACAGCTTCCGGCAGTCCCTCCTGGGCTCCCGCCGTGGCCGCTCCTCCTTGTCTTTAGCCA
AGAGTGTTTCTACCACCAACATTGCTGGACATTTCAATGATGAGTCTCCCCTGGGGCTGC
GCCGGATCCTCTCACAGTCCACAGACTCCCTCAACATGCGGAACCGAACCCTATCCGTGG
AATCCCTCATTGACGAAGCAGAGGTAATCTACAGTGAGCTGATGAGTGACTTTGAGATGG
ATGAGAAGGACTTTGCAGCTGACTCTTGGAGTCTTGCTGTGGACAGCAGCTTCCTGCAGC
AGCATAAAAAGGAGGTGATGAAGCAGCAAGATGTCATCTATGAGCTAATCCAGACAGAGC
TGCACCATGTGAGGACACTGAAGATCATGACCCGCCTCTTCCGCACGGGGATGCTGGAAG
AGCTACACTTGGAGCCAGGAGTGGTCCAGGGCCTGTTCCCCTGCGTGGACGAGCTCAGTG
ACATCCATACACGCTTCCTCAGCCAGCTATTAGAACGCCGACGCCAGGCCCTGTGCCCTG
GCAGCACCCGGAACTTTGTCATCCATCGCTTGGGTGATCTGCTCATCAGCCAGTTCTCAG
GTCCTAGTGCGGAGCAGATGTGTAAGACCTACTCGGAGTTCTGCAGCCGCCACAGCAAGG
CCTTAAAGCTCTATAAGGAGCTGTACGCCCGAGACAAACGCTTCCAGCAATTCATCCGGA
AAGTGACCCGCCCCGCCGTGCTCAAGCGGCACGGGGTACAGGAGTGCATCCTGCTGGTGA
CTCAGCGCATCACCAAGTACCCGTTACTCATCAGCCGCATCCTGCAGCATTCCCACGGGA
TCGAGGAGGAGCGCCAGGACCTGACCACAGCACTGGGGCTAGTGAAGGAGCTGCTGTCCA
ATGTGGACGAGGGTATTTATCAGCTGGAGAAAGGGGCCCGTCTGCAGGAGATCTACAACC
GCATGGACCCTCGGGCCCAAACCCCAGTGCCTGGCAAGGGCCCCTTTGGCCGAGAGGAAC
TTCTGAGGCGCAAACTCATCCACGATGGCTGCCTGCTCTGGAAGACAGCGACGGGGCGCT
TCAAAGATGTGCTAGTGCTGCTGATGACAGATGTACTGGTGTTTCTCCAGGAAAAGGACC
AGAAGTACATCTTTCCTACCCTGGACAAGCCTTCAGTGGTATCGCTGCAGAATCTAATCG
TACGAGACATTGCCAACCAGGAGAAAGGGATGTTTCTGATCAGCGCAGCCCCACCTGAGA
TGTACGAGGTGCACACAGCATCCCGGGATGACCGGAGCACCTGGATCCGGGTCATTCAGC
AGAGCGTGCGCACATGCCCATCCAGGGAGGACTTCCCCCTGATTGAGACAGAGGATGAGG
CTTACCTGCGGCGAATTAAGATGGAGTTGCAGCAGAAGGACCGGGCACTGGTGGAGCTGC
TGCGAGAGAAGGTCGGGCTGTTTGCTGAGATGACCCATTTCCAGGCCGAAGAGGATGGTG
GCAGTGGGATGGCCCTGCCCACCCTGCCCAGGGGCCTTTTCCGCTCTGAGTCCCTTGAGT
CCCCTCGTGGCGAGCGGCTGCTGCAGGATGCCATCCGTGAGGTGGAGGGTCTGAAAGACC
TGCTGGTGGGGCCAGGAGTGGAACTGCTCTTGACACCCCGAGAGCCAGCCCTGCCCTTGG
AACCAGACAGCGGTGGTAACACGAGTCCTGGGGTCACTGCCAATGGTGAGGCCAGAACCT
TCAATGGCTCCATTGAACTCTGCAGAGCTGACTCAGACTCTAGCCAGAGGGATCGAAATG
GAAATCAGCTGAGATCACCGCAAGAGGAGGCGTTACAGCGATTGGTCAATCTCTATGGAC
TTCTACATGGCCTACAGGCAGCTGTGGCCCAGCAGGACACTCTGATGGAAGCCCGGTTCC
CTGAGGGCCCTGAGCGGCGGGAGAAGCTGTGCCGAGCCAACTCTCGGGATGGGGAGGCTG
GCAGGGCTGGGGCTGCCCCTGTGGCCCCTGAAAAGCAGGCCACGGAACTGGCATTACTGC
AGCGGCAACATGCGCTGCTGCAGGAGGAGCTACGGCGCTGCCGGCGGCTAGGTGAAGAAC
GGGCAACCGAAGCTGGCAGCCTGGAGGCCCGGCTCCGGGAGAGTGAGCAGGCCCGGGCAC
TGCTGGAGCGTGAGGCCGAAGAGGCTCGAAGGCAGCTGGCCGCCCTGGGCCAGACCGAGC
CACTCCCAGCTGAGGCCCCCTGGGCCCGCAGACCTGTGGATCCTCGGCGGCGCAGCCTCC
CCGCAGGCGATGCCCTGTACTTGAGTTTCAACCCCCCACAGCCCAGCCGAGGCACTGACC
GCCTGGATCTACCTGTCACTACTCGCTCTGTCCATCGAAACTTTGAGGACCGAGAGAGGC
AGGAACTGGGGAGCCCCGAAGAGCGGCTGCAAGACAGCAGTGACCCTGACACTGGCAGCG
AGGAGGAAGGTAGCAGCCGTCTGTCTCCGCCCCACAGTCCACGAGGTGAGACCCTGGCGG
AGACATGGACCAGAGACTTTACCAGAATGCAGGACATCCCGGAGGAGACGGAGAGCCGCG
ACGGGGAGGCTGTAGCCTCCGAGAGCTAAGGGGGCCCCTCCCCCCTGCCCCGTGCCCCAC
TGAAGAACATTACTGAGGGGGCTAACCTTGGGGACTCCAATTTGCCAATGATGAGGGAAC
ATTTGAAAGAACTGCAAATTGTCCTTGCCAGCTCTTGGGATCCTTGGATACCTGGGGCCA
TTTAAGAAGCTAGGGGAATTAGGCCACAACACCCCCTGGGACATCCGAAAGCTACACCAC
AGATGCCAGTGGTTCATGCCTTCTTCCCGCAACTTTAGGAAAATTTATTTATTTATTGTT
TATTAGTTATGGGGGGAGAGGGGAGATTTAAAGGACCAGGGACATGGGAACCAAGCCATA
GGGATCAGAGGGCCTTGTCCTTGAACACTACTGGGGTATATTCAGGCTCATCCACGCAGC
TGCTGGGTTCTTGCCCTAACGGCCCTCCCCTGCAACATCCGTCTTGGAGGAGAGGCTGCA
GCCACAGCACCCTACTGCCCTTTAAATAAAGGAGGGCTGTGGGCAGGGCCATGTCCCTTT
CTCCTCTCCCCTCAACCTCTTACTGCTGTTCTCCCTTTCTCCGTCCTTCATGGAAGCCCT
GGGAGATAACCTGGCTTCCTGGAGTTGATGGAATAAAGGTTGGGGTGGCCATAATGGTTT
GTTGGGGGTGAGGGAAAAAACCCACAGGGACCAGAATGTTTTGTTGTTCTTTTGTTTTCT
TTTTTGTACCAAAGTCAACTGCACGTGTTTTATATTTTTAAGAGATCGTAGGCAATTAGA
GATCGAAGCCTCCTATCTCCACATCTCTGAAGAAGTTGAGGGGTGGGGGAGAGAATGACT
TCTGCCTTCATCTGCAGTAACGGGGGGACCTATACTGACCTCTTCCCCAGCCATTTAGAA
ACAAGTTCTAGGGTGGGTTGGAAAATCTCCAAGAGCCCTGACCTCATCTTCCACCTCAGC
AACCATGACCTGAAACCTCAGCGTGAATTTGGGGGATTTTTCAGTGGAACCCTTGCCCCC
AAATGTCGACCAGCCCCCAAATGTCGAAGAATTTTCTTCTTGCCAATTTTGTTGTTTAAA
AAAAAAATTCAGGGAAAATTAAAAACCTGGAACTCCATAAGGTACTGTCTTCCATAATGT
CTGCCAATTCTGAGGAGGATGGTAGTAGAGAGCCGGGCAGTGACCTAAGTTCCTCTGAAA
GGGGCCTTTTCCTCTCACCGCAAGGACAGCCTCTGCCTCACTGAAGAGAGGGGGCACTAA
CAAAAGTAACCACTGCAAATCTTTTTTTTGTTTTTTTAATTCACAAATACAAGGATAAAA
ACAAAGGGGCA

Protein Sequence

>9181 : length: 1139
MARMLYPSKGQGLSGPTAENKDVFRRHSWGPGRELEGPLNTRRLQASGCPGPKEALFLQI
REGLDTFLGLQHQGGYASRLDQDSCHPSAGPLDHSATGMLSKSVPVSGINCLLDRSDTDG
NVSQSSAIDLRKRCSQLEGHSGTRVGSSLRQTFSFLSGMTGKAKTREKEKMKEAKDARYT
NGHLFTTISVSGMTMCYACNKSITAKEALICPTCNVTIHNRCKDTLANCTKVKQKQQKAA
LLKNNTALQSVSLRSKTTIRERPSSAIYPSDSFRQSLLGSRRGRSSLSLAKSVSTTNIAG
HFNDESPLGLRRILSQSTDSLNMRNRTLSVESLIDEAEVIYSELMSDFEMDEKDFAADSW
SLAVDSSFLQQHKKEVMKQQDVIYELIQTELHHVRTLKIMTRLFRTGMLEELHLEPGVVQ
GLFPCVDELSDIHTRFLSQLLERRRQALCPGSTRNFVIHRLGDLLISQFSGPSAEQMCKT
YSEFCSRHSKALKLYKELYARDKRFQQFIRKVTRPAVLKRHGVQECILLVTQRITKYPLL
ISRILQHSHGIEEERQDLTTALGLVKELLSNVDEGIYQLEKGARLQEIYNRMDPRAQTPV
PGKGPFGREELLRRKLIHDGCLLWKTATGRFKDVLVLLMTDVLVFLQEKDQKYIFPTLDK
PSVVSLQNLIVRDIANQEKGMFLISAAPPEMYEVHTASRDDRSTWIRVIQQSVRTCPSRE
DFPLIETEDEAYLRRIKMELQQKDRALVELLREKVGLFAEMTHFQAEEDGGSGMALPTLP
RGLFRSESLESPRGERLLQDAIREVEGLKDLLVGPGVELLLTPREPALPLEPDSGGNTSP
GVTANGEARTFNGSIELCRADSDSSQRDRNGNQLRSPQEEALQRLVNLYGLLHGLQAAVA
QQDTLMEARFPEGPERREKLCRANSRDGEAGRAGAAPVAPEKQATELALLQRQHALLQEE
LRRCRRLGEERATEAGSLEARLRESEQARALLEREAEEARRQLAALGQTEPLPAEAPWAR
RPVDPRRRSLPAGDALYLSFNPPQPSRGTDRLDLPVTTRSVHRNFEDRERQELGSPEERL
QDSSDPDTGSEEEGSSRLSPPHSPRGETLAETWTRDFTRMQDIPEETESRDGEAVASES