ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

91653

Name

BOC

Synonym

CDON2;BOC cell adhesion associated, oncogene regulated;BOC;BOC cell adhesion associated, oncogene regulated

Definition

Boc homolog|brother of CDO|brother of CDON|cell adhesion associated, oncogene regulated 2

Position

3q13.2

Gene Type

protein-coding

Pathways and Diseases

Pathway

Signaling events mediated by the Hedgehog family;PID Curated;200144

Pathway

CDO in myogenesis;PID Reactome;500556

Pathway

Myogenesis;Reactome;REACT:21303

External Links

Links to cell senescence gene database

91653

Links to epithelial mesenchymal transition gene database

91653

Links to ovarian cancer gene database

91653

Links to endometrial cancer gene database

91653

Links to iHOP

91653

Sequence Information

Nucleotide Sequence

>91653 : length: 4687
AGCCTCCTCCACTCCCTCCTCCTCCTCCTCCTCGCACGGTAATGGGAGGCTCCTAGGCAG
GAGAAGCAAAAGAAGGAATTGTTTGCGAGTTCAGTCATCCAAAAAGCTTCTTCCATATGG
AGGGACCGGGTGCGCTGGGCGCGGCGTCCCCTGCGTTGTCCTCCTGCTGCCGCCCCCGCG
GCCGCCGCTTTCTGCCGCGGGGACCCTGAGCCCCGGCCCGCCGGTGTCAGCCGCCGCGCG
CGCGCACAGACACACACACAGAGACACACAAACACACACAGAAAAGACACACACGCGCAC
ACACGGCGCGCACACCCTCACGCCCGCCACAGCCACAACACGCCCGCACGCGCCCTCCCT
CTCCGGCCCGCAACTTCTCGGTCCTCGGCTCCTTTGTTGCTCCAGCCGCGGCCGCTCGCC
CGTGTTGTGTGTCCCCGGTGTCACCGAGCGTGTTGTGTGTCCGTGCGGCGCGGCGCTGTG
TGGCTCCCTCGCGCCCACCACGCTGGCCCCCGGGCCCCGGCTCGCCCTTCCCAGGCGCCG
GCTGCAGCAGAGTTTCAGAACAAGCTTCCTGGAACCCATGACCCATGAAGTCTTGTCGAC
ATTTATACCGTCTGAGGGTAGCAGCTCGAAAGTAGAAGAAAGTGTTGCCAGGGACGGCAG
TATCTCTTTGTGTGACCCTGGCGGCTTATGGGACGTTGGCTTCAGACCTTTGTGATACAC
CATGCTGCGTGGGACGATGACGGCGTGGAGAGGAATGAGGCCTGAGGTCACACTGGCTTG
CCTCCTCCTAGCCACAGCAGGCTGCTTTGCTGACTTGAACGAGGTCCCTCAGGTCACCGT
CCAGCCTGCGTCCACCGTCCAGAAGCCCGGAGGCACTGTGATCTTGGGCTGCGTGGTGGA
ACCTCCAAGGATGAATGTAACCTGGCGCCTGAATGGAAAGGAGCTGAATGGCTCGGATGA
TGCTCTGGGTGTCCTCATCACCCACGGGACCCTCGTCATCACTGCCCTTAACAACCACAC
TGTGGGACGGTACCAGTGTGTGGCCCGGATGCCTGCGGGGGCTGTGGCCAGCGTGCCAGC
CACTGTGACACTAGCCAATCTCCAGGACTTCAAGTTAGATGTGCAGCACGTGATTGAAGT
GGATGAGGGAAACACAGCAGTCATTGCCTGCCACCTGCCTGAGAGCCACCCCAAAGCCCA
GGTCCGGTACAGCGTCAAACAAGAGTGGCTGGAGGCCTCCAGAGGTAACTACCTGATCAT
GCCCTCAGGGAACCTCCAGATTGTGAATGCCAGCCAGGAGGACGAGGGCATGTACAAGTG
TGCAGCCTACAACCCAGTGACCCAGGAAGTGAAAACCTCCGGCTCCAGCGACAGGCTACG
TGTGCGCCGCTCCACCGCTGAGGCTGCCCGCATCATCTACCCCCCAGAGGCCCAAACCAT
CATCGTCACCAAAGGCCAGAGTCTCATTCTGGAGTGTGTGGCCAGTGGAATCCCACCCCC
ACGGGTCACCTGGGCCAAGGATGGGTCCAGTGTCACCGGCTACAACAAGACGCGCTTCCT
GCTGAGCAACCTCCTCATCGACACCACCAGCGAGGAGGACTCAGGCACCTACCGCTGCAT
GGCCGACAATGGGGTTGGGCAGCCCGGGGCAGCGGTCATCCTCTACAATGTCCAGGTGTT
TGAACCCCCTGAGGTCACCATGGAGCTATCCCAGCTGGTCATCCCCTGGGGCCAGAGTGC
CAAGCTTACCTGTGAGGTGCGTGGGAACCCCCCGCCCTCCGTGCTGTGGCTGAGGAATGC
TGTGCCCCTCATCTCCAGCCAGCGCCTCCGGCTCTCCCGCAGGGCCCTGCGCGTGCTCAG
CATGGGGCCTGAGGACGAAGGCGTCTACCAGTGCATGGCCGAGAACGAGGTTGGGAGCGC
CCATGCCGTAGTCCAGCTGCGGACCTCCAGGCCAAGCATAACCCCAAGGCTATGGCAGGA
TGCTGAGCTGGCTACTGGCACACCTCCTGTATCACCCTCCAAACTCGGCAACCCTGAGCA
GATGCTGAGGGGGCAACCGGCGCTCCCCAGACCCCCAACGTCAGTGGGGCCTGCTTCCCC
GCAGTGTCCAGGAGAGAAGGGGCAGGGGGCTCCCGCCGAGGCTCCCATCATCCTCAGCTC
GCCCCGCACCTCCAAGACAGACTCATATGAACTGGTGTGGCGGCCTCGGCATGAGGGCAG
TGGCCGGGCGCCAATCCTCTACTATGTGGTGAAACACCGCAAGGTCACAAATTCCTCTGA
CGATTGGACCATCTCTGGCATTCCAGCCAACCAGCACCGCCTGACCCTCACCAGACTTGA
CCCCGGGAGCTTGTATGAAGTGGAGATGGCAGCTTACAACTGTGCGGGAGAGGGCCAGAC
AGCCATGGTCACCTTCCGAACTGGACGGCGGCCCAAACCCGAGATCATGGCCAGCAAAGA
GCAGCAGATCCAGAGAGACGACCCTGGAGCCAGTCCCCAGAGCAGCAGCCAGCCAGACCA
CGGCCGCCTCTCCCCCCCAGAAGCTCCCGACAGGCCCACCATCTCCACGGCCTCCGAGAC
CTCAGTGTACGTGACCTGGATTCCCCGTGGGAATGGTGGGTTCCCAATCCAGTCCTTCCG
TGTGGAGTACAAGAAGCTAAAGAAAGTGGGAGACTGGATTCTGGCCACCAGCGCCATCCC
CCCATCGCGGCTGTCCGTGGAGATCACGGGCCTAGAGAAAGGCACCTCCTACAAGTTTCG
AGTCCGGGCTCTGAACATGCTGGGGGAGAGCGAGCCCAGCGCCCCCTCTCGGCCCTACGT
GGTGTCGGGCTACAGCGGTCGCGTGTACGAGAGGCCCGTGGCAGGTCCTTATATCACCTT
CACGGATGCGGTCAATGAGACCACCATCATGCTCAAGTGGATGTACATCCCAGCAAGTAA
CAACAACACCCCAATCCATGGCTTTTATATCTATTATCGACCCACAGACAGTGACAATGA
TAGTGACTACAAGAAGGATATGGTGGAAGGGGACAAGTACTGGCACTCCATCAGCCACCT
GCAGCCAGAGACCTCCTACGACATTAAGATGCAGTGCTTCAATGAAGGAGGGGAGAGCGA
GTTCAGCAACGTGATGATCTGTGAGACCAAAGCTCGGAAGTCTTCTGGCCAGCCTGGTCG
ACTGCCACCCCCAACTCTGGCCCCACCACAGCCGCCCCTTCCTGAAACCATAGAGCGGCC
GGTGGGCACTGGGGCCATGGTGGCTCGCTCCAGCGACCTGCCCTATCTGATTGTCGGGGT
CGTCCTGGGCTCCATCGTTCTCATCATCGTCACCTTCATCCCCTTCTGCTTGTGGAGGGC
CTGGTCTAAGCAAAAACATACAACAGACCTGGGTTTTCCTCGAAGTGCCCTTCCACCCTC
CTGCCCGTATACTATGGTGCCATTGGGAGGACTCCCAGGCCACCAGGCCAGTGGACAGCC
CTACCTCAGTGGCATCAGTGGACGGGCCTGTGCTAATGGGATCCACATGAATAGGGGCTG
CCCCTCGGCTGCAGTGGGCTACCCGGGCATGAAGCCCCAGCAGCACTGCCCAGGCGAGCT
TCAGCAGCAGAGTGACACCAGCAGCCTGCTGAGGCAGACCCATCTTGGCAATGGATATGA
CCCCCAAAGTCACCAGATCACGAGGGGTCCCAAGTCTAGCCCGGACGAGGGCTCTTTCTT
ATACACACTGCCCGACGACTCCACTCACCAGCTGCTGCAGCCCCATCACGACTGCTGCCA
ACGCCAGGAGCAGCCTGCTGCTGTGGGCCAGTCAGGGGTGAGGAGAGCCCCCGACAGTCC
TGTCCTGGAAGCAGTGTGGGACCCTCCATTTCACTCAGGGCCCCCATGCTGCTTGGGCCT
TGTGCCAGTTGAAGAGGTGGACAGTCCTGACTCCTGCCAAGTGAGTGGAGGAGACTGGTG
TCCCCAGCACCCCGTAGGGGCCTACGTAGGACAGGAACCTGGAATGCAGCTCTCCCCGGG
GCCACTGGTGCGTGTGTCTTTTGAAACACCACCTCTCACAATTTAGGCAGAAGCTGATAT
CCCAGAAAGACTATATATTGTTTTTTTTTTAAAAAAAAAAAGAAGAAAAAAGAGACAGAG
AAAATTGGTATTTATTTTTCTATTATAGCCATATTTATATATTTATGCACTTGTAAATAA
ATGTATATGTTTTATAATTCTGGAGAGACATAAGGAGTCCTACCCGTTGAGGTTGGAGAG
GGAAAATAAAGAAGCTGCCACCTAACAGGAGTCACCCAGGAAAGCACCGCACAGGCTGGC
GCGGGACAGACTCCTAACCTGGGGCCTCTGCAGTGGCAGGCGAGGCTGCAGGAGGCCCAC
AGATAAGCTGGCAAGAGGAAGGATCCCAGGCACATGGTTCATCACGAGCATGAGGGAACA
GCAAGGGGCACGGTATCACAGCCTGGAGACACCCACACAGATGGCTGGATCCGGTGCTAC
GGGAAACATTTTCCTAAGATGCCCATGAGAACAGACCAAGATGTGTACAGCACTATGAGC
ATTAAAAAACCTTCCAGAATCAATAATCCGTGGCAACATATCTCTGTAAAAACAAACACT
GTAACTTCTAAATAAATGTTTAGTCTTCCCTGTAACCTTCAAACTGAAAAAAAAAAAAAA
AAAAAAA

Protein Sequence

>91653 : length: 1115
MLRGTMTAWRGMRPEVTLACLLLATAGCFADLNEVPQVTVQPASTVQKPGGTVILGCVVE
PPRMNVTWRLNGKELNGSDDALGVLITHGTLVITALNNHTVGRYQCVARMPAGAVASVPA
TVTLANLQDFKLDVQHVIEVDEGNTAVIACHLPESHPKAQVRYSVKQEWLEASRGNYLIM
PSGNLQIVNASQEDEGMYKCAAYNPVTQEVKTSGSSDRLRVRRSTAEAARIIYPPEAQTI
IVTKGQSLILECVASGIPPPRVTWAKDGSSVTGYNKTRFLLSNLLIDTTSEEDSGTYRCM
ADNGVGQPGAAVILYNVQVFEPPEVTMELSQLVIPWGQSAKLTCEVRGNPPPSVLWLRNA
VPLISSQRLRLSRRALRVLSMGPEDEGVYQCMAENEVGSAHAVVQLRTSRPSITPRLWQD
AELATGTPPVSPSKLGNPEQMLRGQPALPRPPTSVGPASPQCPGEKGQGAPAEAPIILSS
PRTSKTDSYELVWRPRHEGSGRAPILYYVVKHRKQVTNSSDDWTISGIPANQHRLTLTRL
DPGSLYEVEMAAYNCAGEGQTAMVTFRTGRRPKPEIMASKEQQIQRDDPGASPQSSSQPD
HGRLSPPEAPDRPTISTASETSVYVTWIPRGNGGFPIQSFRVEYKKLKKVGDWILATSAI
PPSRLSVEITGLEKGTSYKFRVRALNMLGESEPSAPSRPYVVSGYSGRVYERPVAGPYIT
FTDAVNETTIMLKWMYIPASNNNTPIHGFYIYYRPTDSDNDSDYKKDMVEGDKYWHSISH
LQPETSYDIKMQCFNEGGESEFSNVMICETKARKSSGQPGRLPPPTLAPPQPPLPETIER
PVGTGAMVARSSDLPYLIVGVVLGSIVLIIVTFIPFCLWRAWSKQKHTTDLGFPRSALPP
SCPYTMVPLGGLPGHQASGQPYLSGISGRACANGIHMNRGCPSAAVGYPGMKPQQHCPGE
LQQQSDTSSLLRQTHLGNGYDPQSHQITRGPKSSPDEGSFLYTLPDDSTHQLLQPHHDCC
QRQEQPAAVGQSGVRRAPDSPVLEAVWDPPFHSGPPCCLGLVPVEEVDSPDSCQVSGGDW
CPQHPVGAYVGQEPGMQLSPGPLVRVSFETPPLTI