ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

9138

Name

ARHGEF1

Synonym

GEF1|LBCL2|LSC|P115-RHOGEF|SUB1.5;Rho guanine nucleotide exchange factor (GEF) 1;ARHGEF1;Rho guanine nucleotide exchange factor (GEF) 1

Definition

115 kDa guanine nucleotide exchange factor|115-kD protein|Lsc homolog|p115RhoGEF|rho guanine nucleotide exchange factor 1

Position

19q13.13

Gene Type

protein-coding

Pathways and Diseases

Pathway

Vascular smooth muscle contraction;KEGG PATHWAY;hsa04270

Pathway

Axon guidance mediated by semaphorins;PANTHER;P00007

Pathway

Heterotrimeric G-protein signaling pathway-Gq alpha and Go alpha mediated pathway;PANTHER;P00027

Pathway

LPA receptor mediated events;PID Curated;200011

Pathway

G alpha (12/13) signalling events;PID Reactome;500437

Pathway

Regulation of RhoA activity;PID Curated;200050

Pathway

Signaling by GPCR;Reactome;REACT:14797

Pathway

Regulation of actin cytoskeleton;KEGG PATHWAY;hsa04810

Pathway

Axonal growth inhibition (RHOA activation);PID Reactome;500619

Pathway

Thromboxane A2 receptor signaling;PID Curated;200069

Pathway

Axonal growth stimulation;PID Reactome;500618

Pathway

Signalling by NGF;Reactome;REACT:11061

Pathway

p75NTR regulates axonogenesis;PID Reactome;500617

Pathway

Cytoskeletal regulation by Rho GTPase;PANTHER;P00016

Disease

Herpes;FunDO

Disease

Eating disorder;FunDO

External Links

Links to cell senescence gene database

9138

Links to epithelial mesenchymal transition gene database

9138

Links to ovarian cancer gene database

9138

Links to endometrial cancer gene database

9138

Links to iHOP

9138

Sequence Information

Nucleotide Sequence

>9138 : length: 3589
CGAGATACGGAAACGCTGGCCCTCCAAGACAGGCCAGAGCGGCCCTATCTGGCCTGCGTG
GCGCAGTACAGCGCTAGAGCGGCCGGCGGGAGGAGTAGAGTCGTCGGGGCCGGAGCCCGG
CAGGAGCCGGGCTAGAGCGGCTGGCAGGAGGAGTGGAGCTGGGCGCAAAGGTGGACTCAG
GGCGGCTAGAGCGACGCGGCGGCAGGGGTGGGGAGAGTGCGGAGCCCGAGCGCGGAGGCT
TCGGTTCCGGTGGCGGCGATGGCTTCTCTTTCCACCTGGAGCAGCCCTGCAGAGCCCAGG
GAGATGGAAGACTTCGCCCGAGGGGCGGCCTCCCCAGGCCCCTCCCGGCCTGGCCTGGTT
CCCGTCAGCATCATCGGGGCTGAGGATGAGGATTTTGAGAACGAGCTGGAGACAAACTCA
GAAGAGCAAAACAGCCAGTTCCAGAGCCTGGAGCAGGTGAAGCGGCGCCCAGCCCACCTC
ATGGCCCTCCTGCAGCACGTGGCCCTGCAGTTTGAGCCAGGACCCCTGCTTTGCTGTCTG
CATGCCGACATGCTGGGCTCACTGGGCCCCAAGGAGGCCAAGAAGGCCTTCCTGGACTTC
TACCACAGCTTCCTGGAGAAGACAGCGGTTCTCCGGGTGCCGGTCCCTCCCAACGTCGCC
TTTGAACTTGACCGCACTAGGGCTGACCTCATCTCCGAGGATGTCCAGCGGCGGTTCGTG
CAGGAGGTGGTGCAAAGCCAGCAGGTAGCCGTGGGCCGGCAGCTGGAGGACTTCCGTTCC
AAGCGGCTCATGGGCATGACGCCCTGGGAGCAGGAGCTGGCCCAGCTGGAGGCTTGGGTT
GGGCGGGACCGAGCCAGCTACGAGGCCCGGGAGCGGCACGTGGCGGAGCGGCTGCTCATG
CACCTGGAGGAGATGCAACATACCATCTCTACCGACGAAGAAAAGAGTGCTGCCGTGGTC
AACGCCATTGGCCTGTACATGCGCCACCTTGGGGTGCGGACCAAGAGTGGAGACAAGAAG
TCGGGGAGGAACTTCTTCCGGAAAAAGGTGATGGGGAACCGGCGGTCGGACGAGCCTGCC
AAGACCAAGAAGGGGCTGAGCAGCATCCTGGATGCCGCCCGCTGGAACCGGGGAGAGCCC
CAGGTTCCAGATTTTCGACACCTCAAAGCAGAGGTTGATGCCGAGAAGCCAGGTGCTACA
GACCGGAAGGGAGGCGTGGGGATGCCCTCTCGGGACCGGAATATCGGGGCTCCTGGGCAG
GACACCCCTGGAGTCTCTCTGCACCCTCTGTCCCTGGACAGCCCAGACCGGGAACCAGGT
GCTGACGCCCCCCTGGAGCTGGGGGACTCATCCCCGCAGGGCCCAATGAGCCTGGAGTCC
TTGGCGCCCCCAGAGAGTACCGACGAGGGGGCCGAAACCGAGAGAAGGTGGAAGAGGCTA
TCAGGGCGTCTGGGGCGCTCAGAGAGCCTGCGGGTGAGTGACCGCCGCCGGCCTTCCCGG
GGCAGCCTCGGGGCTAAGGGCCGGGGTGGGGGCCGCTCCCGGAGCGACGTGGACATGGAC
CCCAGTTCCGCCACGGCAGTGCTTGGCCCTGCCCGACGAGCCACCCCCGAGCCTGGAGAT
GAGGGGGAGCCGGGGCGGTCGGGACTGGAGCTTGAACCAGAAGAGCCTCCCGGCTGGCGG
GAACTCGTCCCCCCAGACACCCTGCACAGCCTGCCCAAGAGCCAGGTGAAGCGGCAGGAG
GTCATCAGCGAGCTGCTGGTGACAGAGGCGGCCCACGTGCGCATGCTGCGGGTGCTGCAC
GACCTCTTCTTCCAGCCCATGGCAGAATGCCTGTTCTTCCCCTTGGAGGAGCTGCAGAAC
ATCTTCCCCAGCCTGGACGAGCTCATCGAGGTGCATTCCCTGTTCCTCGATCGCCTGATG
AAGCGGAGGCAGGAGAGTGGCTACCTCATCGAGGAGATCGGAGACGTGCTGCTGGCCCGG
TTTGATGGTGCTGAGGGCTCCTGGTTCCAGAAAATCTCCTCCCGCTTCTGCAGCCGCCAG
TCATTTGCCTTAGAGCAGCTCAAAGCCAAGCAACGCAAGGACCCTCGGTTCTGTGCCTTC
GTGCAGGAAGCTGAGAGCCGCCCGCGGTGCCGCCGCCTGCAGCTGAAGGACATGATCCCC
ACGGAGATGCAGCGGCTGACCAAGTACCCCCTGCTCCTGCAGAGCATCGGGCAGAACACA
GAAGAGCCCACAGAACGGGAGAAAGTGGAGCTGGCAGCCGAGTGCTGCCGGGAAATTCTA
CACCACGTCAACCAAGCCGTGCGTGACATGGAGGACCTGCTGAGGCTCAAGGACTATCAG
CGGCGCCTGGACTTGTCCCACCTTCGGCAGAGCAGCGACCCTATGCTGAGCGAGTTCAAG
AACCTGGACATCACCAAGAAGAAATTGGTCCACGAGGGCCCACTGACGTGGCGGGTGACT
AAGGACAAGGCAGTGGAGGTGCATGTGCTGCTGCTGGACGACCTGCTGCTGCTGCTCCAG
CGCCAGGACGAGCGGCTGCTGCTCAAGTCCCATAGCCGGACACTGACGCCCACGCCCGAT
GGCAAGACCATGCTGCGGCCCGTGCTGCGGCTCACCTCCGCCATGACCCGCGAGGTGGCC
ACCGATCACAAAGCCTTCTACGTCCTTTTTACCTGGGACCAGGAGGCCCAGATATACGAG
CTGGTGGCACAGACTGTGTCGGAGCGGAAAAACTGGTGTGCTCTCATCACTGAGACTGCC
GGATCCCTGAAAGTCCCTGCCCCTGCCTCTCGCCCTAAGCCCCGGCCCAGCCCGAGCAGC
ACCCGAGAACCCCTCCTCAGCAGCTCTGAGAACGGCAATGGTGGCCGAGAGACGTCTCCA
GCTGATGCCCGGACCGAGAGAATCCTCAGTGACCTCCTGCCCTTCTGCAGACCAGGCCCC
GAGGGCCAGCTCGCTGCCACGGCCCTTCGGAAAGTGCTGTCCCTGAAGCAGCTTCTGTTT
CCGGCGGAGGAAGACAATGGGGCGGGGCCTCCTCGAGATGGGGATGGGGTCCCAGGGGGC
GGCCCCCTGAGCCCAGCACGGACCCAGGAAATCCAGGAGAACCTGCTCAGCTTGGAGGAG
ACCATGAAGCAGCTGGAGGAGTTGGAGGAGGAATTTTGCCGCCTGAGACCCCTCCTGTCT
CAGCTTGGGGGGAACTCTGTCCCCCAGCCTGGCTGCACTTGAGGTTCCCGCCCAGGAAGG
CCTTTTGCAAGAAGGAGAGGAATGGGGGAGAGGACGTGAGGGACCACCCCCACCCACACA
GCTGCCGCAGCATCTCACACCCCGAGGGCCTGAGGAGAGGGAGCTGTGGGCCACGCCTGG
GAGGGGCCCAGCTGGGGTTACTGGCCCCGCATGAGCCTCGGCCATCTCTCCCTCCTGCCC
TCTGCTTGGGGGACTCAGGGCTCCATTCTGGAGGGCACCACGGTGACCCGGGCCATCTCA
GTATTGCCTGTGGGGGCCACCCCTCCACCCCCACCCCCAAGTGCCTTCGCTCTGTTTTTA
TACCCTGAATTGGAGGTTTATTTTTTAATATATATTATCTAAGAAGAGA

Protein Sequence

>9138 : length: 1041
MASLSTWSSPAEPREMEDFARGAASPGPSRPGLVPVSIIGAEDEDFENELETNSEEQNSQ
FQSLEQVKRRPAHLMALLQHVALQFEPGPLLCCLHADMLGSLGPKEAKKAFLDFYHSFLE
KTAVLRVPVPPNVAFELDRTRADLISEDVQRRFVQEVVQSQQVAVGRQLEDFRSKRLMGM
TPWEQELAQLEAWVGRDRASYEARERHVAERLLMHLEEMQHTISTDEEKSAAVVNAIGLY
MRHLGVRTKSGDKKSGRNFFRKKVMGNRRSDEPAKTKKGLSSILDAARWNRGEPQVPDFR
HLKAEVDAEKPGATDRKGGVGMPSRDRNIGAPGQDTPGVSLHPLSLDSPDREPGADAPLE
LGDSSPQGPMSLESLAPPESTDEGAETERRWKRLSGRLGRSESLRVSDRRRPSRGSLGAK
GRGGGRSRSDVDMDPSSATAVLGPARRATPEPGDEGEPGRSGLELEPEEPPGWRELVPPD
TLHSLPKSQVKRQEVISELLVTEAAHVRMLRVLHDLFFQPMAECLFFPLEELQNIFPSLD
ELIEVHSLFLDRLMKRRQESGYLIEEIGDVLLARFDGAEGSWFQKISSRFCSRQSFALEQ
LKAKQRKDPRFCAFVQEAESRPRCRRLQLKDMIPTEMQRLTKYPLLLQSIGQNTEEPTER
EKVELAAECCREILHHVNQAVRDMEDLLRLKDYQRRLDLSHLRQSSDPMLSEFKNLDITK
KKLVHEGPLTWRVTKDKAVEVHVLLLDDLLLLLQRQDERLLLKSHSRTLTPTPDGKTMLR
PVLRLTSAMTREVATDHKAFYVLFTWDQEAQIYELVAQTVSERKNWCALITETAGSLKVP
APASRPKPRPSPSSTREPLLSSSENGNGGRETSPADARTERILSDLLPFCRPGPEGQLAA
TALRKGVGGGILPPETPPVSAWGELCPPAWLHLRFPPRKAFCKKERNGGEDVRDHPHPHS
CRSISHPEGLRRGSCGPRLGGAQLGLLAPHEPRPSLPPALCLGDSGLHSGGHHGDPGHLS
IACGGHPSTPTPKCLRSVFIP