ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

9133

Name

CCNB2

Synonym

HsT17299;cyclin B2;CCNB2;cyclin B2

Definition

G2/mitotic-specific cyclin-B2

Position

15q22.2

Gene Type

protein-coding

Pathways and Diseases

Pathway

Progesterone-mediated oocyte maturation;KEGG PATHWAY;hsa04914

Pathway

Cell Cycle Checkpoints;Reactome;REACT:1538

Pathway

Cyclin B2 mediated events;PID Reactome;500975

Pathway

Oocyte meiosis;KEGG PATHWAY;hsa04114

Pathway

p53 signaling pathway;KEGG PATHWAY;hsa04115

Pathway

Cell cycle;KEGG PATHWAY;hsa04110

Pathway

FOXM1 transcription factor network;PID Curated;200120

Pathway

Cell Cycle, Mitotic;Reactome;REACT:152

Disease

Yersinia infection;FunDO

Disease

Lung cancer;FunDO

External Links

Links to cell senescence gene database

9133

Links to epithelial mesenchymal transition gene database

9133

Links to ovarian cancer gene database

9133

Links to endometrial cancer gene database

9133

Links to iHOP

9133

Sequence Information

Nucleotide Sequence

>9133 : length: 1566
GGGCCGCCCAATGGGGCGCAAGCGACGCGGTATTTGAATCCTGGAACAAGGCTACAGCGT
CGAAGATCCCCAGCGCTGCGGGCTCGGAGAGCAGTCCTAACGGCGCCTCGTACGCTAGTG
TCCTCCCTTTTCAGTCCGCGTCCCTCCCTGGGCCGGGCTGGCACTCTTGCCTTCCCCGTC
CCTCATGGCGCTGCTCCGACGCCCGACGGTGTCCAGTGATTTGGAGAATATTGACACAGG
AGTTAATTCTAAAGTTAAGAGTCATGTGACTATTAGGCGAACTGTTTTAGAAGAAATTGG
AAATAGAGTTACAACCAGAGCAGCACAAGTAGCTAAGAAAGCTCAGAACACCAAAGTTCC
AGTTCAACCCACCAAAACAACAAATGTCAACAAACAACTGAAACCTACTGCTTCTGTCAA
ACCAGTACAGATGGAAAAGTTGGCTCCAAAGGGTCCTTCTCCCACACCTGAGGATGTCTC
CATGAAGGAAGAGAATCTCTGCCAAGCTTTTTCTGATGCCTTGCTCTGCAAAATCGAGGA
CATTGATAACGAAGATTGGGAGAACCCTCAGCTCTGCAGTGACTACGTTAAGGATATCTA
TCAGTATCTCAGGCAGCTGGAGGTTTTGCAGTCCATAAACCCACATTTCTTAGATGGAAG
AGATATAAATGGACGCATGCGTGCCATCCTAGTGGATTGGCTGGTACAAGTCCACTCCAA
GTTTAGGCTTCTGCAGGAGACTCTGTACATGTGCGTTGGCATTATGGATCGATTTTTACA
GGTTCAGCCAGTTTCCCGGAAGAAGCTTCAATTAGTTGGGATTACTGCTCTGCTCTTGGC
TTCCAAGTATGAGGAGATGTTTTCTCCAAATATTGAAGACTTTGTTTACATCACAGACAA
TGCTTATACCAGTTCCCAAATCCGAGAAATGGAAACTCTAATTTTGAAAGAATTGAAATT
TGAGTTGGGTCGACCCTTGCCACTACACTTCTTAAGGCGAGCATCAAAAGCCGGGGAGGT
TGATGTTGAACAGCACACTTTAGCCAAGTATTTGATGGAGCTGACTCTCATCGACTATGA
TATGGTGCATTATCATCCTTCTAAGGTAGCAGCAGCTGCTTCCTGCTTGTCTCAGAAGGT
TCTAGGACAAGGAAAATGGAACTTAAAGCAGCAGTATTACACAGGATACACAGAGAATGA
AGTATTGGAAGTCATGCAGCACATGGCCAAGAATGTGGTGAAAGTAAATGAAAACTTAAC
TAAATTCATCGCCATCAAGAATAAGTATGCAAGCAGCAAACTCCTGAAGATCAGCATGAT
CCCTCAGCTGAACTCAAAAGCCGTCAAAGACCTTGCCTCCCCACTGATAGGAAGGTCCTA
GGCTGCCGTGGCCCCTGGGGATGTGTGCTTCATTGTGCCCTTTTTCTTATTGGTTTAGAA
CTCTTGATTTTGTACATAGTCCTCTGGTCTATCTCATGAAACCTCTTCTCAGACCAGTTT
TCTAAACATATATTGAGGAAAAATAAAGCGATTGGTTTTTCTTAAGGTAAAAAAAAAAAA
AAAAAA

Protein Sequence

>9133 : length: 398
MALLRRPTVSSDLENIDTGVNSKVKSHVTIRRTVLEEIGNRVTTRAAQVAKKAQNTKVPV
QPTKTTNVNKQLKPTASVKPVQMEKLAPKGPSPTPEDVSMKEENLCQAFSDALLCKIEDI
DNEDWENPQLCSDYVKDIYQYLRQLEVLQSINPHFLDGRDINGRMRAILVDWLVQVHSKF
RLLQETLYMCVGIMDRFLQVQPVSRKKLQLVGITALLLASKYEEMFSPNIEDFVYITDNA
YTSSQIREMETLILKELKFELGRPLPLHFLRRASKAGEVDVEQHTLAKYLMELTLIDYDM
VHYHPSKVAAAASCLSQKVLGQGKWNLKQQYYTGYTENEVLEVMQHMAKNVVKVNENLTK
FIAIKNKYASSKLLKISMIPQLNSKAVKDLASPLIGRS