ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

9098

Name

USP6

Synonym

HRP1|TRE17|TRE2|TRESMCR|Tre-2|USP6-short;ubiquitin specific peptidase 6;USP6;ubiquitin specific peptidase 6

Definition

TBC1D3 and USP32 fusion|deubiquitinating enzyme 6|hyperpolymorphic gene 1|proto-oncogene TRE-2|ubiquitin carboxyl-terminal hydrolase 6|ubiquitin specific peptidase 6 (Tre-2 oncogene)|ubiquitin specific protease 6 (Tre-2 oncogene)|ubiquitin thioesterase 6|

Position

17p13

Gene Type

protein-coding

Pathways and Diseases

Pathway

Arf6 signaling events;PID Curated;200060

Disease

Cancer;FunDO

Disease

Bone disease;FunDO

External Links

Links to cell senescence gene database

9098

Links to epithelial mesenchymal transition gene database

9098

Links to ovarian cancer gene database

9098

Links to endometrial cancer gene database

9098

Links to iHOP

9098

Sequence Information

Nucleotide Sequence

>9098 : length: 8723
CTGAGCTGGATCCTGAATGAGATGCATGACCAGGACAAGAAATTGGTGGAGAAGAGCTAC
AAGGATGCCAAGGGCTGTTTCTTCAGCATGAGAGAGGGGCTGAACTGCGAGGTGGCCACC
AACACAGAGGCCCTGCAGAGCGGCAGGATAGAGATATGGAGCTCTACATCTCTGTGCAGA
ACCTGAGCCATCCCAGCTCAGCAAGGTAGGGCCTCTGTCCCCTCCCCACCCTGTACCTAT
CACCCCAGGGTGAGCCCAGCCTTATAGACCCCTGCTTGGAGGTGTGTTACGGGACCCAAC
TGGCCCAGCTGCAGGGGCTCATCAGAAGCATGGAGCAGCAGCTGTGCGAGCTCTGCTGCG
ACGCGGAGCACCAGGACCATGAGCACCAGGTCCTTCTGGACGTGAAGACACGGCTGGAGC
AGGAGATCGCCACCTACAGCCGCTTGCTAGAGGTTGAGGACGCTCAAGTCACAGGGAGAA
GACGTCCACCCACACATCAGGAGACAGGCCTGGAACAGAGCCTTCCTGCACAGCCTCAGA
AGGGACCCACCCTGGTGACACCTTGATCTTGGACTGACACTCATGACCTCCAGTACTGTG
AGACAGTAACATTCTGTTGTTGAAGGTGCCCAGTCTGTGGTACTGTAAAACAGCCCTGGG
AAACTAACGCAGCCTGTTAGCCCACAGATGGTGAAGGGATGGAATGCTCCACGGAGCTCC
AGGCTTACTATCTACAGCCCCCAAAGTGTGCTGCGGGACCCTTGGGTGGGTGTAGGTATG
CAAGGTAATTTTGGGTGGTTCAAGGTGAATAATTTCAATTGACATAATAATGTATTTATC
TTGCTGGGTAAATGAGGGATACCCAACTGTTAGGAACCAGGCAACACAGCAGGAGGTGAG
CAGCCAGCCAGTGAGCAAAGCTTCATCTGTAGAAACAGCCACTTCCCATCCCTCGCATTA
CCGCATGAGCTCTGCCTCCTGTCAGATGAGCGGTGCCGTTAGATTCTCACAGAAGCATGA
ACCCTACTGTGAACTGCGCATGCCAGGGATCTAGATTGCGTGCTCCTTATGAGAACCTAA
TGCCTGATGATCTGTGACTGTCTCATCACTGCCAGATGGAACCACGTAGTTGCAGGAAAA
CAAGTTCAGGGCTCCCACTGATTCTACATTATGGGCTGTCATTGGGACAGTCTGAGATGG
GGAGTCGGGGGAGACAATGGATGAATGGATGGATGAATGGACAGCAGTCCAGGGAGATGT
CCCTGTGTGTCCTGAACTGGGCCCTTCCTCCAGTGAGAAGCCTTCCTGAGCTGACTTGGG
GACAGTGGCTATGGTATGGGCGGTGTTGGCCTCTGGGCAGCTACAGAGGAGGGTCATCCC
TGAGCACTCACCGGGCGCCCGTTCTACACTGCCCATGTAGACGATTTTCTCTTTCGTCTT
CATGGTGGCTTCGTAGAGTGGGTGCTGTTCCCGAATGTACCCATTCGACAGGTGAGCCGT
CTGGGGTCAGAGAGGCAGTAACTGGCCTGGGAATCCAGACAAGACCCTGGGTTTTGCTCT
CAGCCCTGCTGTGTGCCATGCTAGACTTCAGGCCTCAACCCTGAGACCTCCCTGCTCTAG
ATCCCAAATCTGCCCAGATTTCCGATCCCAATGGGGCAGAGCCTGGCCCTGGCAGAGACA
CTGGGATGGATCCACTGTGGGTGGGGAGGAGGGAAGGGTCCTCAGAACACACCTGGGGCC
TAAGCTGGGTCTTGATGGTCACTGTGGGACCCACTGGACACACACAGTCCCTTGTCTGGG
AGTGGCATGGGGAGCCTTCTGCCCTTGGGCAGTTGTGGAAAGTGAAGGAGCCCTGGAGAG
CTGGCTGAGGGGAGACTATCTTCCCTTGTGTTCAAAGGGGTCCAGGCACTGGGGCTCTCC
CCAAGTATTTCTTATTCTGTCTGGCCTCGCTTTCCTTTTGCCCTGAGTATTCTCAGGAGG
GACGGTCCATCTAGATGTCCTCCAGGAGCAAGGACCCACTGTTCTTCATCAGTGACCCAG
GAAAATGAAGCCCCCTCCTGTGGGGACAGCTCAGAATGGTGGAGTCCACAGTCCCTCCCT
GAGAGACATGGTTTCCATGAGCACAGTGGCTGCTTTGGAGACAGTAATCATTTTCATCCC
CAAAACCAAACACACTCCTGCTCAAATGGTGTTATTGCTAAAGCAGCTTCACTGGTTAGA
CTGAAGGGCCATGGTAGCCCAAGTGATGAGCGGGGTAGAATGGAGCAGTCAGGAGAGATC
TTGTTCCCCGTAGGAAACTGGGCATCTCTGTGGCCCTGAACATCCCAGGAGGCCGATCGT
ACAGAGACCTCTGGTGCCTGACCGCAGTTCACATCCACATCCCTGGAATAGACCATCACA
GGCTCTTCACCCTTGGCAGGTGGACACCATTCAACCTGCCGGGGCAGGATGGACATGGTA
GAGAATGCAGATAGTTTGCAGGCACAGGAGCGGAAGGACATACTTATGAAGTATGACAAG
GGACACCGAGCTGGGCTGCCAGAGGACAAGGGGCCTGAGCCCGTTGGAATCAACAGCAGC
ATTGATCGTTTTGGCATTTTGCATGAGACGGAGCTGCCTCCTGTGACTGCACGGGAGGCG
AAGAAAATTCGGCGGGAGATGACACGAACGAGCAAGTGGATGGAAATGCTGGGAGAATGG
GAGACATATAAGCACAGTAGCAAACTCATAGATCGAGTGTACAAGGGAATTCCCATGAAC
ATCCGGGGCCCGGTGTGGTCAGTCCTCCTGAACATTCAGGAAATCAAGTTGAAAAACCCC
GGAAGATACCAGATCATGAAGGAGAGGGGCAAGAGGTCATCTGAACACATCCACCACATC
GACCTGGACGTGAGGACGACTCTCCGGAACCATGTCTTCTTTAGGGATCGATATGGAGCC
AAGCAGAGGGAACTATTCTACATCCTCCTGGCCTATTCGGAGTATAACCCGGAGGTGGGC
TACTGCAGGGACCTGAGCCACATCACCGCCTTGTTCCTCCTTTATCTGCCTGAGGAGGAC
GCATTCTGGGCACTGGTGCAGCTGCTGGCCAGTGAGAGGCACTCCCTGCCAGGATTCCAC
AGCCCAAATGGTGGGACAGTCCAGGGGCTCCAAGACCAACAGGAGCATGTGGTACCCAAG
TCACAACCCAAGACCATGTGGCATCAGGACAAGGAAGGTCTATGCGGGCAGTGTGCCTCG
TTAGGCTGCCTTCTCCGGAACCTGATTGACGGGATCTCTCTCGGGCTCACCCTGCGCCTG
TGGGACGTGTATTTGGTGGAAGGAGAACAGGTGTTGATGCCAATAACCAGCATTGCTCTT
AAGGTTCAGCAGAAGCGCCTCATGAAGACATCCAGGTGTGGCCTGTGGGCACGTCTGCGG
AACCAATTCTTCGATACCTGGGCCATGAACGATGACACCGTGCTCAAGCATCTTAGGGCC
TCTACGAAGAAACTAACAAGGAAGCAAGGGGACCTGCCACCCCCAGCCAAACGCGAGCAA
GGGTCCTTGGCACCCAGGCCTGTGCCGGCTTCACGTGGTGGGAAGACCCTCTGCAAGGGG
TATAGGCAGGCCCCTCCAGGCCCACCAGCCCAGTTCCAGCGGCCCATTTGCTCAGCTTCC
CCGCCATGGGCATCTCGTTTTTCCACGCCCTGTCCTGGTGGGGCTGTCCGGGAAGACACG
TACCCTGTGGGCACTCAGGGTGTGCCCAGCCTGGCCCTGGCTCAGGGAGGACCTCAGGGT
TCCTGGAGATTCCTGGAGTGGAAGTCAATGCCCCGGCTCCCAACGGACCTGGATATAGGG
GGCCCTTGGTTCCCCCATTATGATTTTGAATGGAGCTGCTGGGTCCGTGCCATATCCCAG
GAGGACCAGCTGGCCACCTGCTGGCAGGCTGAACACTGCGGAGAGGTTCACAACAAAGAT
ATGAGTTGGCCTGAGGAGATGTCTTTTACAGCAAATAGTAGTAAAATAGATAGACAAAAG
GTTCCCACAGAAAAGGGAGCCACAGGTCTAAGCAACCTGGGAAACACATGCTTCATGAAC
TCAAGCATCCAGTGCGTTAGTAACACACAGCCACTGACACAGTATTTTATCTCAGGGAGA
CATCTTTATGAACTCAACAGGACAAATCCCATTGGTATGAAGGGGCATATGGCTAAATGC
TATGGTGATTTAGTGCAGGAACTCTGGAGTGGAACTCAGAAGAGTGTTGCCCCATTAAAG
CTTCGGCGGACCATAGCAAAATATGCTCCCAAGTTTGATGGGTTTCAGCAACAAGACTCC
CAAGAACTTCTGGCTTTTCTCTTGGATGGTCTTCATGAAGATCTCAACCGAGTCCATGAA
AAGCCATATGTGGAACTGAAGGACAGTGATGGCCGACCAGACTGGGAAGTAGCTGCAGAG
GCCTGGGACAACCATCTAAGAAGAAATAGATCAATTATTGTGGATTTGTTCCATGGGCAG
CTAAGATCTCAAGTCAAATGCAAGACATGTGGGCATATAAGTGTCCGATTTGACCCTTTC
AATTTTTTGTCTTTGCCACTACCAATGGACAGTTACATGGACTTAGAAATAACAGTGATT
AAGTTAGATGGTACTACCCCTGTACGGTATGGACTAAGACTGAATATGGATGAAAAGTAC
ACAGGTTTAAAAAAACAGCTGAGGGATCTCTGTGGACTTAATTCAGAACAAATCCTACTA
GCAGAAGTACATGATTCCAACATAAAGAACTTTCCTCAGGATAACCAAAAAGTACAACTC
TCAGTGAGCGGATTTTTGTGTGCATTTGAAATTCCTGTCCCTTCATCTCCAATTTCAGCT
TCTAGTCCAACACAAATAGATTTCTCCTCTTCACCATCTACAAATGGAATGTTCACCCTA
ACTACCAATGGGGACCTACCCAAACCAATATTCATCCCCAATGGAATGCCAAACACTGTT
GTGCCATGTGGAACTGAGAAGAACTTCACAAATGGAATGGTTAATGGTCACATGCCATCT
CTTCCTGACAGCCCCTTTACAGGTTACATCATTGCAGTCCACCGAAAAATGATGAGGACA
GAACTGTATTTCCTGTCACCTCAGGAGAATCGCCCCAGCCTCTTTGGAATGCCATTGATT
GTTCCATGCACTGTGCATACCCGGAAGAAAGACCTATATGATGCGGTTTGGATTCAAGTA
TCCTGGTTAGCAAGACCACTCCCACCTCAGGAAGCTAGTATTCATGCCCAGGATCGTGAT
AACTGTATGGGCTATCAATATCCATTCACTCTACGAGTTGTGCAGAAAGATGGGAACTCC
TGTGCTTGGTGCCCACAGTATAGATTTTGCAGAGGCTGTAAAATTGATTGTGGGGAAGAC
AGAGCTTTCATTGGAAATGCCTATATTGCTGTGGATTGGCACCCCACAGCCCTTCACCTT
CGCTATCAAACATCCCAGGAAAGGGTTGTAGATAAGCATGAGAGTGTGGAGCAGAGTCGG
CGAGCGCAAGCCGAGCCCATCAACCTGGACAGCTGTCTCCGTGCTTTCACCAGTGAGGAA
GAGCTAGGGGAAAGTGAGATGTACTACTGTTCCAAGTGTAAGACCCACTGCTTAGCAACA
AAGAAGCTGGATCTCTGGAGGCTTCCACCCTTCCTGATTATTCACCTTAAGCGATTTCAA
TTTGTAAATGATCAGTGGATAAAATCACAGAAAATTGTCAGATTTCTTCGGGAAAGTTTT
GATCCGAGTGCTTTTTTGGTACCACGAGACCCGGCCCTCTGCCAGCATAAACCACTCACA
CCCCAGGGGGATGAGCTCTCCAAGCCCAGGATTCTGGCAAGAGAGGTGAAGAAAGTGGAT
GCGCAGAGTTCGGCTGGAAAAGAGGACATGCTCCTAAGCAAAAGCCCATCCTCACTCAGC
GCTAACATCAGCAGCAGCCCAAAAGGTTCTCCTTCTTCATCAAGAAAAAGTGGAACCAGC
TGTCCCTCCAGCAAAAACAGCAGCCCTAATAGCAGCCCACGGACTTTGGGGAGGAGCAAA
GGGAGGCTCCGGCTGCCCCAGATTGGCAGCAAAAATAAGCCGTCAAGTAGTAAGAAGAAC
TTGGATGCCAGCAAAGAGAATGGGGCTGGGCAGATCTGTGAGCTGGCTGACGCCTTGAGC
CGAGGGCATATGCGGGGGGGCAGCCAACCAGAGCTGGTCACTCCTCAGGACCATGAGGTA
GCTTTGGCCAATGGATTCCTTTATGAGCATGAAGCATGTGGCAATGGCTGTGGCGATGGC
TACAGCAATGGTCAGCTTGGAAACCACAGTGAAGAAGACAGCACTGATGACCAAAGAGAA
GACACTCATATTAAGCCTATTTATAATCTATATGCAATTTCATGCCATTCAGGAATTCTG
AGTGGGGGCCATTACATCACTTATGCCAAAAACCCAAACTGCAAGTGGTACTGTTATAAT
GACAGCAGCTGTGAGGAACTTCACCCTGATGAAATTGACACCGACTCTGCCTACATTCTT
TTCTATGAGCAGCAGGGGATAGACTACGCACAATTTCTGCCAAAGATTGATGGCAAAAAG
ATGGCAGACACAAGCAGTACGGATGAAGACTCTGAGTCTGATTACGAAAAGTACTCTATG
TTACAGTAAAGCTACCACTCTGGCTGCTAGACAGCTTGGTGGCGAGGGAGATGACTCCTT
GTAGCTGATACTTGGCAAAAGTGTCACTGAAAGACAAGCTAAATGTAGTTATTTTATCCT
GTTAGAACAAAAATTCTAATTAAAATAGTTAACTTGAAGAGTAGAAACAATTGTATTTTG
AAGTCTCATACAAGCTGTCTGATAGAGAACTTTCAGGCAGATCCCACCATTAGCCTGTAA
ACAAAAGGTGTGGCACCAGCCACCTGGGACCAAATAAGAATTGAATTGTGCTTGTCCAGA
TATGAACAAATATGTAGTGAGTATAGAGTTTACCAATAATCATAACAAATATTAAAGATT
TCCTTGGAGTCAGAGGAAAAAACAAACAATTATAATGTTGTCTAGGGACGACATGATACG
CTACCTCCTTTTTCCTGAAGTTTTATTCCATTATATTGACAAGATGGAGAAAGCAAGATC
ATGAAGGTGTGCAAATGATTCTTACGGCATGGACAAGGATTTTTCAATTTATTTTTTAAA
CTGTTTCCATACCCTTTCTTTTTCTTGCTTTTTGTTTTTGCCATTGTGTTTACGTTTGAG
ACACAACCAGTCATTGGTGGCAGGGGCATAGAGTGGTCAGTCTGAAAGGGAGGCTCTCTT
AAGAGCTATGTGCCTTCCAACCAGAGGGAGACCCAGTAGAAAGAAAAACATCCTGGGAAA
TCCAGCTACCAGGGCCCTCCCAGTGGAGGCATCTTACATTTAGGCTACTTCAAGTATCCT
CAGAAATGTATTCTGCACCCCCGGCCCCGCCCATGCTGAGGGAAGGGGAGCAGTTGCCAA
TATTTGCACCATCTTCACATGCACATGTTGCAACAAGAGCTTCTGGGAAGGTAAGCGGCA
TCGGAGCTAGATCACGTTTCACAATTAGTGGTTATTCTTTTCTGTGTTTGTTTTGCACTT
TAAAAAAGAGAGAACACATGCAAATGAACTTGCTTGTGTGTATTTGATGGCTCTAAGGGC
TATAAATTACAAACAAAACACATCCCAGACATTAGGAGTTCATAAGTATATTTAATGAAA
TTGGTGGTTTTAGGAAGTCAACTTTAGTTTTGCTTTGTTTGCATGTCCACTGGTTTTTTT
ATTTTGATATTTGTCTTTTTTTAAATTTTACAGTAGTCATTGAAAGTTATGTTTCTTTGC
TTACTTCATTTTTTCCCTCTAATTATTTAAGATTGGAACAAAAGTATAAATATTATTTAT
TTGAGGTAGAATTTTTTTCATGTAGTTTCTTAATATATACTTGAAGGAAATGTTTCACCT
TATTTTTGGTCTTTGTTTATTCATTTAGACCCTGCAAGTTGATTCTCATTGCCAGATTCC
ATTACCCTTTCTTCCTCATAGGTAGTAATTACCAATGTAACTAAGCATTTGTGTTCTGAT
ATCTGAGGCCAGTAACTATTAATATCTAGTTCTCAGAGCATTTGGAAAGGTTATCTTAAA
TGGCTACCTAAATTGAAATCCTTTTCAGAAAAAATATAATTGCAAGTAGGTAGGAGTGGC
CTAAATTGTCTAATGTAATAAAGTCAGACAAAATGCACACTTTATAGTTTCAAGATTTTC
AGTAAATAAAATCTGTCCATTCCTACCTGGACATGTCCCATTAAAAAGTGGAAGATTTTA
AATAATTTCTTTACAGATGTTTTATTTAAACAGGTAGCACAATCTACTAATGTTGTGTGA
TTTGTGTTATACTGGTTGTAATTAATTTTTTTAATTCATGAACTAGCGGAAAATTTATTA
AATTAACTATTAACTACATTCACCTTGTAAATTACTGTATAAAACTTGTTGACAATGCAC
TGACTTTAGAAAGATGTTAATGTACATAAATAGAGTGTAAATAAAATAGTGTTGATGTAC
TGAAATATGAACTGTATCAAAAGTATTGGTAATTGTATATGGGGTGTACCTGTTTATCTG
TTAACTATTATCCAAACAAATTAAATACTGTGGTTGCCTCTATGTGCTGTTTTTCCTCAT
ACAAGTAAACACAGAAAGTCAAA

Protein Sequence

>9098 : length: 1406
MDMVENADSLQAQERKDILMKYDKGHRAGLPEDKGPEPVGINSSIDRFGILHETELPPVT
AREAKKIRREMTRTSKWMEMLGEWETYKHSSKLIDRVYKGIPMNIRGPVWSVLLNIQEIK
LKNPGRYQIMKERGKRSSEHIHHIDLDVRTTLRNHVFFRDRYGAKQRELFYILLAYSEYN
PEVGYCRDLSHITALFLLYLPEEDAFWALVQLLASERHSLPGFHSPNGGTVQGLQDQQEH
VVPKSQPKTMWHQDKEGLCGQCASLGCLLRNLIDGISLGLTLRLWDVYLVEGEQVLMPIT
SIALKVQQKRLMKTSRCGLWARLRNQFFDTWAMNDDTVLKHLRASTKKLTRKQGDLPPPA
KREQGSLAPRPVPASRGGKTLCKGYRQAPPGPPAQFQRPICSASPPWASRFSTPCPGGAV
REDTYPVGTQGVPSLALAQGGPQGSWRFLEWKSMPRLPTDLDIGGPWFPHYDFEWSCWVR
AISQEDQLATCWQAEHCGEVHNKDMSWPEEMSFTANSSKIDRQKVPTEKGATGLSNLGNT
CFMNSSIQCVSNTQPLTQYFISGRHLYELNRTNPIGMKGHMAKCYGDLVQELWSGTQKSV
APLKLRRTIAKYAPKFDGFQQQDSQELLAFLLDGLHEDLNRVHEKPYVELKDSDGRPDWE
VAAEAWDNHLRRNRSIIVDLFHGQLRSQVKCKTCGHISVRFDPFNFLSLPLPMDSYMDLE
ITVIKLDGTTPVRYGLRLNMDEKYTGLKKQLRDLCGLNSEQILLAEVHDSNIKNFPQDNQ
KVQLSVSGFLCAFEIPVPSSPISASSPTQIDFSSSPSTNGMFTLTTNGDLPKPIFIPNGM
PNTVVPCGTEKNFTNGMVNGHMPSLPDSPFTGYIIAVHRKMMRTELYFLSPQENRPSLFG
MPLIVPCTVHTRKKDLYDAVWIQVSWLARPLPPQEASIHAQDRDNCMGYQYPFTLRVVQK
DGNSCAWCPQYRFCRGCKIDCGEDRAFIGNAYIAVDWHPTALHLRYQTSQERVVDKHESV
EQSRRAQAEPINLDSCLRAFTSEEELGESEMYYCSKCKTHCLATKKLDLWRLPPFLIIHL
KRFQFVNDQWIKSQKIVRFLRESFDPSAFLVPRDPALCQHKPLTPQGDELSKPRILAREV
KKVDAQSSAGKEDMLLSKSPSSLSANISSSPKGSPSSSRKSGTSCPSSKNSSPNSSPRTL
GRSKGRLRLPQIGSKNKPSSSKKNLDASKENGAGQICELADALSRGHMRGGSQPELVTPQ
DHEVALANGFLYEHEACGNGCGDGYSNGQLGNHSEEDSTDDQREDTHIKPIYNLYAISCH
SGILSGGHYITYAKNPNCKWYCYNDSSCEELHPDEIDTDSAYILFYEQQGIDYAQFLPKI
DGKKMADTSSTDEDSESDYEKYSMLQ