ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

898

Name

CCNE1

Synonym

CCNE;cyclin E1;CCNE1;cyclin E1

Definition

G1/S-specific cyclin-E1|cyclin E variant ex5del|cyclin E variant ex7del|cyclin Es|cyclin Et

Position

19q12

Gene Type

protein-coding

Pathways and Diseases

Pathway

influence of ras and rho proteins on g1 to s transition;PID BioCarta;100054

Pathway

il-2 receptor beta chain in t cell activation;PID BioCarta;100129

Pathway

Small cell lung cancer;KEGG PATHWAY;hsa05222

Pathway

BARD1 signaling events;PID Curated;200174

Pathway

cdk regulation of dna replication;PID BioCarta;100110

Pathway

cell cycle: g1/s check point;PID BioCarta;100160

Pathway

Signaling events mediated by PRL;PID Curated;200006

Pathway

e2f1 destruction pathway;PID BioCarta;100034

Pathway

Regulation of retinoblastoma protein;PID Curated;200191

Pathway

E2F transcription factor network;PID Curated;200027

Pathway

p53 pathway;PANTHER;P00059

Pathway

Parkinson disease;PANTHER;P00049

Pathway

Cyclin E associated events during G1/S transition;PID Reactome;500877

Pathway

p53 signaling pathway;PID BioCarta;100083

Pathway

Prostate cancer;KEGG PATHWAY;hsa05215

Pathway

Cell Cycle, Mitotic;Reactome;REACT:152

Pathway

cyclin e destruction pathway;PID BioCarta;100166

Pathway

Cell cycle;KEGG PATHWAY;hsa04110

Pathway

Pathways in cancer;KEGG PATHWAY;hsa05200

Pathway

mTOR signaling pathway;PID Curated;200080

Pathway

Cell cycle;PANTHER;P00013

Pathway

cyclins and cell cycle regulation;PID BioCarta;100207

Pathway

PLK3 signaling events;PID Curated;200186

Pathway

Cell Cycle Checkpoints;Reactome;REACT:1538

Pathway

Oocyte meiosis;KEGG PATHWAY;hsa04114

Pathway

p53 pathway feedback loops 2;PANTHER;P04398

Pathway

p53 signaling pathway;KEGG PATHWAY;hsa04115

Pathway

regulation of p27 phosphorylation during cell cycle progression;PID BioCarta;100087

Disease

Cancers;KEGG DISEASE

Disease

Gastric cancer;KEGG DISEASE;H00018

Disease

Testicular dysfunction;FunDO

Disease

Cancer;FunDO

Disease

Cancers of the digestive system;KEGG DISEASE

Disease

Head and neck cancers;KEGG DISEASE

Disease

Laryngeal cancer;KEGG DISEASE;H00055

External Links

Links to cell senescence gene database

898

Links to epithelial mesenchymal transition gene database

898

Links to ovarian cancer gene database

898

Links to endometrial cancer gene database

898

Links to iHOP

898

Sequence Information

Nucleotide Sequence

>898 : length: 2021
AGCAGCCGGCGCGGCCGCCAGCGCGGTGTAGGGGGCAGGCGCGGATCCCGCCACCGCCGC
GCGCTCGGCCCGCCGACTCCCGGCGCCGCCGCCGCCACTGCCGTCGCCGCCGCCGCCTGC
CGGGACTGGAGCGCGCCGTCCGCCGCGGACAAGACCCTGGCCTCAGGCCGGAGCAGCCCC
ATCATGCCGAGGGAGCGCAGGGAGCGGGATGCGAAGGAGCGGGACACCATGAAGGAGGAC
GGCGGCGCGGAGTTCTCGGCTCGCTCCAGGAAGAGGAAGGCAAACGTGACCGTTTTTTTG
CAGGATCCAGATGAAGAAATGGCCAAAATCGACAGGACGGCGAGGGACCAGTGTGGGAGC
CAGCCTTGGGACAATAATGCAGTCTGTGCAGACCCCTGCTCCCTGATCCCCACACCTGAC
AAAGAAGATGATGACCGGGTTTACCCAAACTCAACGTGCAAGCCTCGGATTATTGCACCA
TCCAGAGGCTCCCCGCTGCCTGTACTGAGCTGGGCAAATAGAGAGGAAGTCTGGAAAATC
ATGTTAAACAAGGAAAAGACATACTTAAGGGATCAGCACTTTCTTGAGCAACACCCTCTT
CTGCAGCCAAAAATGCGAGCAATTCTTCTGGATTGGTTAATGGAGGTGTGTGAAGTCTAT
AAACTTCACAGGGAGACCTTTTACTTGGCACAAGATTTCTTTGACCGGTATATGGCGACA
CAAGAAAATGTTGTAAAAACTCTTTTACAGCTTATTGGGATTTCATCTTTATTTATTGCA
GCCAAACTTGAGGAAATCTATCCTCCAAAGTTGCACCAGTTTGCGTATGTGACAGATGGA
GCTTGTTCAGGAGATGAAATTCTCACCATGGAATTAATGATTATGAAGGCCCTTAAGTGG
CGTTTAAGTCCCCTGACTATTGTGTCCTGGCTGAATGTATACATGCAGGTTGCATATCTA
AATGACTTACATGAAGTGCTACTGCCGCAGTATCCCCAGCAAATCTTTATACAGATTGCA
GAGCTGTTGGATCTCTGTGTCCTGGATGTTGACTGCCTTGAATTTCCTTATGGTATACTT
GCTGCTTCGGCCTTGTATCATTTCTCGTCATCTGAATTGATGCAAAAGGTTTCAGGGTAT
CAGTGGTGCGACATAGAGAACTGTGTCAAGTGGATGGTTCCATTTGCCATGGTTATAAGG
GAGACGGGGAGCTCAAAACTGAAGCACTTCAGGGGCGTCGCTGATGAAGATGCACACAAC
ATACAGACCCACAGAGACAGCTTGGATTTGCTGGACAAAGCCCGAGCAAAGAAAGCCATG
TTGTCTGAACAAAATAGGGCTTCTCCTCTCCCCAGTGGGCTCCTCACCCCGCCACAGAGC
GGTAAGAAGCAGAGCAGCGGGCCGGAAATGGCGTGACCACCCCATCCTTCTCCACCAAAG
ACAGTTGCGCGCCTGCTCCACGTTCTCTTCTGTCTGTTGCAGCGGAGGCGTGCGTTTGCT
TTTACAGATATCTGAATGGAAGAGTGTTTCTTCCACAACAGAAGTATTTCTGTGGATGGC
ATCAAACAGGGCAAAGTGTTTTTTATTGAATGCTTATAGGTTTTTTTTAAATAAGTGGGT
CAAGTACACCAGCCACCTCCAGACACCAGTGCGTGCTCCCGATGCTGCTATGGAAGGTGC
TACTTGACCTAAGGGACTCCCACAACAACAAAAGCTTGAAGCTGTGGAGGGCCACGGTGG
CGTGGCTCTCCTCGCAGGTGTTCTGGGCTCCGTTGTACCAAGTGGAGCAGGTGGTTGCGG
GCAAGCGTTGTGCAGAGCCCATAGCCAGCTGGGCAGGGGGCTGCCCTCTCCACATTATCA
GTTGACAGTGTACAATGCCTTTGATGAACTGTTTTGTAAGTGCTGCTATATCTATCCATT
TTTTAATAAAGATAATACTGTTTTTGAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

Protein Sequence

>898 : length: 410
MPRERRERDAKERDTMKEDGGAEFSARSRKRKANVTVFLQDPDEEMAKIDRTARDQCGSQ
PWDNNAVCADPCSLIPTPDKEDDDRVYPNSTCKPRIIAPSRGSPLPVLSWANREEVWKIM
LNKEKTYLRDQHFLEQHPLLQPKMRAILLDWLMEVCEVYKLHRETFYLAQDFFDRYMATQ
ENVVKTLLQLIGISSLFIAAKLEEIYPPKLHQFAYVTDGACSGDEILTMELMIMKALKWR
LSPLTIVSWLNVYMQVAYLNDLHEVLLPQYPQQIFIQIAELLDLCVLDVDCLEFPYGILA
ASALYHFSSSELMQKVSGYQWCDIENCVKWMVPFAMVIRETGSSKLKHFRGVADEDAHNI
QTHRDSLDLLDKARAKKAMLSEQNRASPLPSGLLTPPQSGKKQSSGPEMA