ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

8941

Name

CDK5R2

Synonym

NCK5AI|P39|p39nck5ai;cyclin-dependent kinase 5, regulatory subunit 2 (p39);CDK5R2;cyclin-dependent kinase 5, regulatory subunit 2 (p39)

Definition

CDK5 activator 2|cyclin-dependent kinase 5 activator 2|cyclin-dependent kinase 5 activator isoform p39i|cyclin-dependent kinase 5 regulatory subunit 2|neuronal CDK5 activator isoform|p39I

Position

2q35

Gene Type

protein-coding

Pathways and Diseases

Pathway

Lissencephaly gene (LIS1) in neuronal migration and development;PID Curated;200114

External Links

Links to cell senescence gene database

8941

Links to epithelial mesenchymal transition gene database

8941

Links to ovarian cancer gene database

8941

Links to endometrial cancer gene database

8941

Links to iHOP

8941

Sequence Information

Nucleotide Sequence

>8941 : length: 2528
GGGTGGGGCTGACGCTGCAGCTGGCGCAGCTCAGGATTAGAGCAGCGGAGCCGCCTAGCA
GCCACCTTCCCCCGCCAGTCCGCGCGCCCGGGCCGGGGCTAGGCCCCCCACCGCCGGGTC
CCCCGGGGCTGCAGTAGCAGCGGCGCCGCCCGCGGCTCCCGCTGGGGCCTGGGCGCCGGC
CCCGCTCTGCAGGATGGGCACAGTGCTGTCTCTTTCGCCTGCCTCCTCGGCCAAGGGCCG
GAGGCCCGGCGGGCTGCCCGAGGAGAAGAAGAAGGCGCCGCCCGCGGGGGACGAGGCGCT
GGGGGGCTACGGGGCGCCGCCAGTGGGCAAGGGCGGCAAAGGCGAGAGCCGACTCAAGCG
GCCGTCCGTGCTCATCTCGGCGCTCACCTGGAAGCGCCTGGTGGCCGCGTCCGCCAAGAA
GAAGAAAGGCAGCAAGAAGGTGACACCCAAGCCGGCATCCACGGGCCCCGACCCCCTGGT
CCAGCAACGCAACCGCGAGAACCTTCTCCGCAAGGGCCGGGATCCCCCCGACGGCGGCGG
CACCGCCAAGCCCCTGGCGGTGCCAGTGCCCACCGTGCCCGCGGCTGCCGCCACCTGCGA
GCCACCGTCGGGGGGCAGCGCGGCCGCTCAGCCGCCGGGCTCGGGCGGGGGAAAGCCTCC
GCCGCCGCCTCCCCCAGCCCCGCAGGTGGCGCCGCCGGTGCCTGGCGGCTCGCCGCGGCG
GGTCATCGTGCAGGCGTCCACCGGCGAGCTGCTGCGCTGTCTGGGCGACTTCGTGTGCCG
ACGCTGCTATCGCCTCAAGGAGCTGAGCCCGGGCGAGCTGGTGGGCTGGTTCCGCGGTGT
GGACCGCTCGCTGCTGCTGCAGGGCTGGCAAGACCAGGCCTTCATTACGCCTGCAAACCT
GGTGTTCGTGTACCTGCTGTGCCGCGAGTCGCTGCGTGGGGACGAGCTGGCGTCGGCCGC
CGAGCTGCAGGCCGCCTTCCTCACCTGCCTCTACCTCGCCTACTCCTACATGGGCAACGA
GATCTCCTACCCACTCAAGCCCTTCCTCGTGGAGCCCGACAAGGAGCGCTTCTGGCAGCG
CTGCCTGCGCCTCATCCAGCGGCTCAGCCCGCAGATGCTGCGGCTCAACGCCGACCCCCA
CTTCTTCACGCAGGTCTTTCAAGACCTCAAGAACGAGGGCGAGGCCGCCGCCAGCGGCGG
GGGCCCACCGAGCGGGGGCGCGCCCGCCGCCTCCTCGGCCGCCAGGGACAGCTGCGCGGC
CGGAACCAAGCACTGGACTATGAACCTGGACCGCTAGGGATACCCAGGGGCCGCGCCCAT
CCCCCGCCCCAGCCCCTGACACACACTCGGACCCCCCGGGACCACAAAGCCACCGCCGCT
GTTACCGCCGCTCAGCGCCCCGGCTGGGCGGAGGAGGAGACGCCCATGCCCCTCAGGGGA
AAGTGGAGACCGGGACACCAGAGGCCGCGGTGTTTGGATTTGCTGGGCGTGGAGTGGGGA
CGGAAGATGAGCGCGGGAAAGGCACTCCAACCTCACTCTTCCCGTCTGTCTGCGCCCCCA
TTTCTCCATTTCTGCCGGGGTCTCCCCCTTCCCTTCAGCCCATTCCCCCTCGGTTTTATC
CATTTCCTTGCCTCCTTTTTGTGTCTTCATTTTTCCTCCTGTCTGCATTCCTCTCTCTCT
CTCTCCCTCTCTCTCCTGTTCCTCTCTTTCTTCCTCCCTCTCCCTGCCTTTCCATTTTCC
GTTCCTTGGGTTTGTGTGTCTGCATCTCCATCTTACCCCTTGCCTGACTGTACCCCGTAG
ACCCCTGTTTCTCCTCCTGCACCTGTGTCCCCATCTGCCCTTCTTGTTGCTCCTGTCATG
TGTCACCATCTTCCCTCCTGTCTGCCTTCTTCCTCCACTTGTGTCAGCTTGCATTTTTTT
ATTCCTGACTGAGTCACCACACCCCTCTCCCCTGATCAAAGGGAATATTAGTTTTTAATT
TGGATCGACTGAGGTGCCAGGAGAAACTGCAGTCCCAGGTATCCAGACAGCCACCAGGAT
GGTCCCTCGCCCCACCCCCACCGCCTCTCCCCACCTTTTCCAACGTGTTGCATGCTGGGA
GCTGGGGGGTGTGGGGGAAGGGGCTGCCGGCTTCTTTCAGGAGGCTGAGGTTTGGAGGCA
AAATCAACCTGGGAGACCACCCCGGCCGCGGCGCCTCAGTGGACAGGTGGGAGGAAAAGA
AAACTTCTTACCTTGGAGGAGGGACATCCCGCTTCCTTATCCTTAGCTTTTTTGTTGCTC
CTCCCCACTGCCCCTTTTAATTTATTTGGTTGTTTGCGGAGGGAGGGGGGAGGGGGGTAG
GCTGGGCCGGGAACTGTCCGAGGTGCTGAGCTGGGGCGGGACCGGAATCCTCCCGGTAGG
GTACCAGGGACTGAGTTGGGCCTGGGGCCGTGTCCAAGGTGCCAATGATGCGGGCCGACA
GAGCGGGCCGCACTGTCTGTCTGTCCGTCTGTCCCGGAAAGAACTATAAAGCGCTGGAAG
CGCCTGCA

Protein Sequence

>8941 : length: 367
MGTVLSLSPASSAKGRRPGGLPEEKKKAPPAGDEALGGYGAPPVGKGGKGESRLKRPSVL
ISALTWKRLVAASAKKKKGSKKVTPKPASTGPDPLVQQRNRENLLRKGRDPPDGGGTAKP
LAVPVPTVPAAAATCEPPSGGSAAAQPPGSGGGKPPPPPPPAPQVAPPVPGGSPRRVIVQ
ASTGELLRCLGDFVCRRCYRLKELSPGELVGWFRGVDRSLLLQGWQDQAFITPANLVFVY
LLCRESLRGDELASAAELQAAFLTCLYLAYSYMGNEISYPLKPFLVEPDKERFWQRCLRL
IQRLSPQMLRLNADPHFFTQVFQDLKNEGEAAASGGGPPSGGAPAASSAARDSCAAGTKH
WTMNLDR