ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

891

Name

CCNB1

Synonym

CCNB;cyclin B1;CCNB1;cyclin B1

Definition

G2/mitotic-specific cyclin B1|G2/mitotic-specific cyclin-B1

Position

5q12

Gene Type

protein-coding

Pathways and Diseases

Pathway

il-2 receptor beta chain in t cell activation;PID BioCarta;100129

Pathway

Direct p53 effectors;PID Curated;200101

Pathway

FOXM1 transcription factor network;PID Curated;200120

Pathway

Phosphorylation of the APC/C;PID Reactome;500395

Pathway

akap95 role in mitosis and chromosome dynamics;PID BioCarta;100247

Pathway

cell cycle: g2/m checkpoint;PID BioCarta;100159

Pathway

APC/C:Cdc20 mediated degradation of Cyclin B;PID Reactome;500397

Pathway

Validated targets of C-MYC transcriptional activation;PID Curated;200045

Pathway

Cyclin A/B1 associated events during G2/M transition;PID Reactome;500991

Pathway

PLK1 signaling events;PID Curated;200087

Pathway

p53 pathway;PANTHER;P00059

Pathway

Chk1/Chk2(Cds1) mediated inactivation of Cyclin B:Cdk1 complex;PID Reactome;500318

Pathway

Progesterone-mediated oocyte maturation;KEGG PATHWAY;hsa04914

Pathway

Phosphorylation of Emi1;PID Reactome;500392

Pathway

how progesterone initiates the oocyte maturation;PID BioCarta;100104

Pathway

regulation of cell cycle progression by plk3;PID BioCarta;100068

Pathway

Recruitment of NuMA to mitotic centrosomes;PID Reactome;500382

Pathway

Cell cycle;KEGG PATHWAY;hsa04110

Pathway

G2/M DNA replication checkpoint;PID Reactome;500939

Pathway

stathmin and breast cancer resistance to antimicrotubule agents;PID BioCarta;100027

Pathway

cyclins and cell cycle regulation;PID BioCarta;100207

Pathway

sonic hedgehog receptor ptc1 regulates cell cycle;PID BioCarta;100060

Pathway

Cell Cycle Checkpoints;Reactome;REACT:1538

Pathway

Regulation of APC/C activators between G1/S and early anaphase;PID Reactome;500391

Pathway

Oocyte meiosis;KEGG PATHWAY;hsa04114

Pathway

FoxO family signaling;PID Curated;200091

Pathway

p53 signaling pathway;KEGG PATHWAY;hsa04115

Pathway

C-MYB transcription factor network;PID Curated;200130

Pathway

Cell Cycle, Mitotic;Reactome;REACT:152

Disease

Cancer;FunDO

External Links

Links to cell senescence gene database

891

Links to epithelial mesenchymal transition gene database

891

Links to ovarian cancer gene database

891

Links to endometrial cancer gene database

891

Links to iHOP

891

Sequence Information

Nucleotide Sequence

>891 : length: 2177
CGAACGCCTTCGCGCGATCGCCCTGGAAACGCATTCTCTGCGACCGGCAGCCGCCAATGG
GAAGGGAGTGAGTGCCACGAACAGGCCAATAAGGAGGGAGCAGTGCGGGGTTTAAATCTG
AGGCTAGGCTGGCTCTTCTCGGCGTGCTGCGGCGGAACGGCTGTTGGTTTCTGCTGGGTG
TAGGTCCTTGGCTGGTCGGGCCTCCGGTGTTCTGCTTCTCCCCGCTGAGCTGCTGCCTGG
TGAAGAGGAAGCCATGGCGCTCCGAGTCACCAGGAACTCGAAAATTAATGCTGAAAATAA
GGCGAAGATCAACATGGCAGGCGCAAAGCGCGTTCCTACGGCCCCTGCTGCAACCTCCAA
GCCCGGACTGAGGCCAAGAACAGCTCTTGGGGACATTGGTAACAAAGTCAGTGAACAACT
GCAGGCCAAAATGCCTATGAAGAAGGAAGCAAAACCTTCAGCTACTGGAAAAGTCATTGA
TAAAAAACTACCAAAACCTCTTGAAAAGGTACCTATGCTGGTGCCAGTGCCAGTGTCTGA
GCCAGTGCCAGAGCCAGAACCTGAGCCAGAACCTGAGCCTGTTAAAGAAGAAAAACTTTC
GCCTGAGCCTATTTTGGTTGATACTGCCTCTCCAAGCCCAATGGAAACATCTGGATGTGC
CCCTGCAGAAGAAGACCTGTGTCAGGCTTTCTCTGATGTAATTCTTGCAGTAAATGATGT
GGATGCAGAAGATGGAGCTGATCCAAACCTTTGTAGTGAATATGTGAAAGATATTTATGC
TTATCTGAGACAACTTGAGGAAGAGCAAGCAGTCAGACCAAAATACCTACTGGGTCGGGA
AGTCACTGGAAACATGAGAGCCATCCTAATTGACTGGCTAGTACAGGTTCAAATGAAATT
CAGGTTGTTGCAGGAGACCATGTACATGACTGTCTCCATTATTGATCGGTTCATGCAGAA
TAATTGTGTGCCCAAGAAGATGCTGCAGCTGGTTGGTGTCACTGCCATGTTTATTGCAAG
CAAATATGAAGAAATGTACCCTCCAGAAATTGGTGACTTTGCTTTTGTGACTGACAACAC
TTATACTAAGCACCAAATCAGACAGATGGAAATGAAGATTCTAAGAGCTTTAAACTTTGG
TCTGGGTCGGCCTCTACCTTTGCACTTCCTTCGGAGAGCATCTAAGATTGGAGAGGTTGA
TGTCGAGCAACATACTTTGGCCAAATACCTGATGGAACTAACTATGTTGGACTATGACAT
GGTGCACTTTCCTCCTTCTCAAATTGCAGCAGGAGCTTTTTGCTTAGCACTGAAAATTCT
GGATAATGGTGAATGGACACCAACTCTACAACATTACCTGTCATATACTGAAGAATCTCT
TCTTCCAGTTATGCAGCACCTGGCTAAGAATGTAGTCATGGTAAATCAAGGACTTACAAA
GCACATGACTGTCAAGAACAAGTATGCCACATCGAAGCATGCTAAGATCAGCACTCTACC
ACAGCTGAATTCTGCACTAGTTCAAGATTTAGCCAAGGCTGTGGCAAAGGTGTAACTTGT
AAACTTGAGTTGGAGTACTATATTTACAAATAAAATTGGCACCATGTGCCATCTGTACAT
ATTACTGTTGCATTTACTTTTAATAAAGCTTGTGGCCCCTTTTACTTTTTTATAGCTTAA
CTAATTTGAATGTGGTTACTTCCTACTGTAGGGTAGCGGAAAAGTTGTCTTAAAAGGTAT
GGTGGGGATATTTTTAAAAACTCCTTTTGGTTTACCTGGGGATCCAATTGATGTATATGT
TTATATACTGGGTTCTTGTTTTATATACCTGGCTTTTACTTTATTAATATGAGTTACTGA
AGGTGATGGAGGTATTTGAAAATTTTACTTCCATAGGACATACTGCATGTAAGCCAAGTC
ATGGAGAATCTGCTGCATAGCTCTATTTTAAAGTAAAAGTCTACCACCGAATCCCTAGTC
CCCCTGTTTTCTGTTTCTTCTTGTGATTGCTGCCATAATTCTAAGTTATTTACTTTTACC
ACTATTTAAGTTATCAACTTTAGCTAGTATCTTCAAACTTTCACTTTGAAAAATGAGAAT
TTTATATTCTAAGCCAGTTTTCATTTTGGTTTTGTGTTTTGGTTAATAAAACAATACTCA
AATACAAAAAAAAAAAA

Protein Sequence

>891 : length: 433
MALRVTRNSKINAENKAKINMAGAKRVPTAPAATSKPGLRPRTALGDIGNKVSEQLQAKM
PMKKEAKPSATGKVIDKKLPKPLEKVPMLVPVPVSEPVPEPEPEPEPEPVKEEKLSPEPI
LVDTASPSPMETSGCAPAEEDLCQAFSDVILAVNDVDAEDGADPNLCSEYVKDIYAYLRQ
LEEEQAVRPKYLLGREVTGNMRAILIDWLVQVQMKFRLLQETMYMTVSIIDRFMQNNCVP
KKMLQLVGVTAMFIASKYEEMYPPEIGDFAFVTDNTYTKHQIRQMEMKILRALNFGLGRP
LPLHFLRRASKIGEVDVEQHTLAKYLMELTMLDYDMVHFPPSQIAAGAFCLALKILDNGE
WTPTLQHYLSYTEESLLPVMQHLAKNVVMVNQGLTKHMTVKNKYATSKHAKISTLPQLNS
ALVQDLAKAVAKV