ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

8880

Name

FUBP1

Synonym

FBP|FUBP|hDH V;far upstream element (FUSE) binding protein 1;FUBP1;far upstream element (FUSE) binding protein 1

Definition

DNA helicase V|far upstream element-binding protein 1

Position

1p31.1

Gene Type

protein-coding

External Links

Links to cell senescence gene database

8880

Links to epithelial mesenchymal transition gene database

8880

Links to ovarian cancer gene database

8880

Links to endometrial cancer gene database

8880

Links to iHOP

8880

Sequence Information

Nucleotide Sequence

>8880 : length: 6029
TTCTCAGCCCTAACCCACACCAGCGCGTTGCCTCGGAAACATCGCGAGATTTTGTTCCTT
CAGTCTCCGCCCCTTTACGGCACGATGGTCGCGCAAGAATGTAATAGAGCTTCGACGGCC
GCCATTTTCTTTCTTTCTTAGCTGTTAGCTGAGAGGAAGTCTCTGAACAGGCGGCAGCGG
CTCTTATAGTGCAACCATGGCAGACTATTCAACAGTGCCTCCCCCCTCTTCTGGCTCAGC
TGGTGGCGGTGGTGGCGGCGGTGGTGGTGGAGGAGTTAACGACGCTTTCAAAGATGCACT
GCAGAGAGCCCGGCAGATTGCAGCAAAAATTGGAGGTGATGCAGGGACATCACTGAATTC
AAATGACTATGGTTATGGGGGACAAAAAAGACCTTTAGAAGATGGAGATGGCTCTTGGAC
AAGTCCGAGCAGTACAACACACTGGGAGGGAATGCCCTCTCCTTTTAAAGATCAACCAGA
TGCTAAGAAAGTTGCTCCTCAAAATGACTCTTTTGGAACACAGTTACCACCGATGCATCA
GCAGCAAAGCAGATCTGTAATGACAGAAGAATACAAAGTTCCAGATGGAATGGTTGGATT
CATAATTGGCAGAGGAGGTGAACAGATCTCACGCATACAACAGGAATCTGGATGCAAAAT
ACAGATAGCTCCTGACAGTGGTGGCCTTCCAGAAAGGTCCTGTATGTTAACTGGAACACC
TGAATCTGTCCAGTCAGCAAAACGGTTACTGGACCAGATTGTTGAAAAAGGAAGACCAGC
TCCTGGCTTCCATCATGGCGATGGACCGGGAAATGCAGTTCAAGAAATCATGATTCCAGC
TAGCAAGGCAGGATTAGTCATTGGAAAAGGGGGAGAAACTATTAAACAGCTTCAGGAACG
GGCTGGAGTTAAAATGGTTATGATTCAAGACGGGCCGCAGAACACTGGTGCTGACAAACC
TCTTAGGATTACAGGAGACCCATATAAAGTTCAACAAGCCAAGGAAATGGTGTTAGAGTT
AATTCGTGATCAAGGCGGTTTCAGAGAAGTTCGGAATGAGTATGGGTCAAGAATAGGAGG
AAATGAAGGGATAGATGTCCCCATTCCAAGATTTGCTGTTGGCATTGTAATAGGAAGAAA
TGGAGAGATGATCAAAAAAATACAAAATGATGCTGGTGTTCGCATTCAGTTTAAGCCAGA
TGATGGGACAACACCCGAAAGGATAGCACAAATAACAGGACCTCCAGACCGATGTCAACA
TGCTGCAGAAATTATTACAGACCTTCTTCGAAGTGTTCAGGCTGGTAATCCTGGTGGACC
TGGACCTGGTGGTCGAGGAAGAGGTAGAGGTCAAGGCAACTGGAACATGGGACCACCTGG
TGGACTACAGGAATTTAATTTTATTGTGCCAACTGGGAAAACTGGATTAATAATAGGAAA
AGGAGGTGAAACCATAAAAAGCATAAGCCAGCAGTCTGGTGCAAGAATAGAACTTCAGAG
AAATCCTCCACCAAATGCAGATCCTAATATGAAGTTATTTACAATTCGTGGCACTCCACA
ACAGATAGACTATGCTCGGCAACTCATAGAAGAAAAGATTGGTGGCCCAGTAAATCCTTT
AGGGCCACCTGTACCCCATGGGCCCCATGGTGTCCCAGGCCCCCATGGACCTCCTGGGCC
TCCAGGGCCTGGAACTCCAATGGGACCATACAACCCTGCACCTTATAATCCTGGACCACC
AGGCCCGGCTCCTCATGGTCCTCCAGCCCCATATGCTCCCCAGGGATGGGGAAATGCATA
TCCACACTGGCAGCAGCAGGCTCCTCCTGATCCAGCTAAGGCAGGAACGGATCCAAATTC
AGCAGCTTGGGCTGCTTATTACGCTCACTATTATCAACAGCAAGCACAGCCACCACCAGC
AGCCCCTGCAGGTGCACCAACTACAACTCAAACTAATGGACAAGGAGATCAGCAGAATCC
AGCCCCAGCTGGACAGGTTGATTATACCAAGGCTTGGGAAGAGTACTACAAGAAAATGGG
TCAGGCAGTTCCTGCTCCGACTGGGGCTCCTCCAGGTGGTCAGCCAGATTATAGTGCAGC
CTGGGCTGAGTATTATAGACAACAAGCAGCCTATTATGCCCAGACAAGTCCCCAGGGAAT
GCCACAGCATCCTCCAGCACCTCAGGGCCAATAATAAGAAGTGGACAATACAGTATTTGC
TTCATTGTGTGGGGGAAAAAAACCTTTGTTAAATATATGGATGCAGACGACTTGATGAAG
ATCTTAATTTTGTTTTTGGTTTAAAATAGTGTTTCCTTTTTTTTTTTTTTTTTTGAAAAT
GTACAAAATATCTATCACTACTGATAGGAGGTTAATATTTCTGTGTAGAAATGAAAATTG
GTTTGTTTTTAGTATTTAGTGTAGATGTACACATTCCAGCAAATGTATTTGCAATTATGT
GGTTGATGCTTTGTGATATAAATGTACTTTTTCAATGTATACTTTCACTTTTAAAATGCC
TGTTTTGTGCTTTACAATAAATGATATGAAACCTCCTGTGTCGGTAAGTTGGATATGTGG
GTATTTAAAGGATTCATAATTTCTTAGCAATGATAAATTAAGATACATATACACAAATAT
ATAAGCTTTCCCCATGAAATATTGAGTTTTTAAACACTGGCATGTTTTTCCCCCCTTGCA
GTATAGTGGTAGATTGGAGGATCTTTTCCATTTATTGTATTGGCTCTTTCAGCACAAGTA
ATCCTGATATCTTCATTTTTTTTCCTTCTGTTTGATTAAAAACTGCATGTGTGTACAATG
ATCTTTTGGCATACTTCCATTGCATTAACAGTGAAATTTCCTTTTATACATGACCACTGT
TTCAGACCTGTACTGCTGCTATAACAGTTAACCTTTCTGTTCTTAATTTGATAATACTTG
ATTTCCAAGACTGTTTCGGCATAACTAATTTTAAACAGTTTTCAGATAGTGAATATGAGT
AGTCTAATAAGAACAGTTTTTTTCCATGTGAAGCAACTCTTTCAATGTATATAATGTTAG
TGTGTTTCTTTCTAAATTTAGGATAGAAAAGTGAATAGTGTGCAAAAAGTATAGCTACAT
TGCATCTGCCATTGAAACATAAATGGGGTATGGAAACGTTCAAGCTTTTTTTTTTTCTTT
ATGCAGTATAGATAAGCTTTGTTTTGTAAATGCACAAGTCCAATCATTGAATCAACTTAA
TTTTTTTATGTACTTGAAGTCATTTTATTACTCTTTAACACTCATGCTGAAGTTCTGATA
TTTTGTTGAAATCCATTGTTTTACTCTTTGCATATTTGTTGGCTCTTTGCATATTAATAT
ATTAGACTACATGCAAATACAGTCTGTCTTGCCATTGTCTGTTGAAGTGCAGGTTTGATC
CAGCCAGTATAGAACTAGCTCTGTAGGGGTGAGGAGGACTGTGCTGTGTATCATCCTTGA
TTGTGTTCCTTCAAGGAGCATTGCACTTGCCTTCCCAGACCTTCCACCTTAGGTTCTGCT
GCAAAAAGCACCAGGTAAGCACAACCTAAGGACATATATAAATAAATATTTCAATACATT
AATGTTGTCCCTGTGAGGTTTTTGTGGTTGTGTATTCAAAGGCAATCTGCTACTGCTTCC
CCAAAATGTATTTTGTTATTTTATGCTACCATCTTAGTGGAAAGTCTGTAAGTTGTTAAA
GCAACTGTTTACATTTCTGGGTAATGTTTTTTATTTTACTTTTTTTTTTTTATTAAGACA
AGAAAATGATGAGTAGATTGCTGCAGTAATTGAACTACATCCAAATCTTTTTGTATTTTT
TCCCCAAATATAGAAGTGTTAATATTAAGAAAGGACAATTACACAGTTTTCAAGATTTAG
GAAATCACTTGTTTAGAAACTTCAACAGCCTTCACAATCTGTTTTATATGATGGACAGAA
AATTTCTTTGCCCTCCAAAATTATAATTTCTTTATTTTTTTCTTATTCTTAAACTATAAT
AATTCAGTAAGGATATTATGGGTTAGAATTTTATTATGATTTTTTTCTTAGACAAAAGTT
ATATGCTGAAGAAGGAAAAAGTTATAAGGCAGTATGTTTTGATAAAAGGCATGTGCATCA
GTGAAATGTTAACTGTATAGCAAATAACCTTTCATAATCTGTAGCAATCAGTATTTTTCT
GATTTAATAATATTTTAATAACTGACGCTGCATTTAATTTTTTTGCCAGTTTAAAATGTT
TGTGTGTTTTTATAGATGATTTTAACTGGTACATATTTTGAGTTAAGTTGAATGTATGAA
AGCAGCATCTTATCAGTTTTGTTTATTCGATTTCTAAAATGTGCTGATCCTTTTAAAACT
CCTGCTTATCTCTGCAACAAAGAAAAATATTCAAAAATACTGCCTTCATTTTCACACACA
GTGCTGAAGATGCTGCAAGCACCAAATCATAGCTCATAAAATCAGGTCCTGAGATAGTTA
CCCATAAAGAGGAATCCTTTGAGTGTATGCCATTGGTGAGCCGATGAGCATGGACCATAG
AAGGGCTCAATGTAGAAGGTAAAATTGGCAAATCATAATTGAGAAATATGAAATGTATTC
CCATACATAATATGGTATAGGGTGTAATGTACCTGCTTTTGATCACTTTTCATTTTAAAG
TGCTATTCACTTGATCTTAAATGTTCCATGAACTGTTAAATTTCTTAAGTTACATAGTTA
CTACACCACATTTATGTGTATGTTATGTTTTAATAGTCAATGATAGGTATGTACAATTGA
TAATATAAAGGGGCTCATTGAAACTTGAGAGCCTGTTGAGTTTTGGTTAGTTGTAGATTG
CATTTTTATAAAAAAAAATACAGATAGATTGATGATAATAGATATTGGGGCATTGTTTCT
GTCTCATGAGAATTCTTTTATTCATTACCATAAGCCTTCACTGATACTATAAGCATTATT
TTAAATGACGCTGATCTTAAGTCTGAAATAAATGGAAAGCAGAAAAGGTGAGCCAGTTGA
TTTGAATGCATTGGATATTAGTGTTAGAAACAATGTATAGTTTAGATTGAAACTGAACTG
ACTTATTTAGCACTTAAACAAAAATTTGACAATGTTTTTAGTTTTTTTTAAGACAGCTTA
GTGTGGTGATACTTAGAATTCTATGGTTTGATGTTTCTTTTAGAAATGAGAAGTATAGTT
TTATTTTTTAATATAAAAAATGGTTTTAATACTAAAACTAGTAATTTGATACTAGTTGTT
TATAAACATTGTAAAATATATCTTTTAAACAAATTATCTTGGTAGTTAATTCATAAGGGT
GGGTTTGGGTAGGAATAGCAGAGTACTTTCAGAGGGAAAGGGGAGTCATTCAGAAGTGAT
AGCATTTTATTTGTTTGAATACTCTGCCAGTAAAATCAGCTGTACTTAGAAAGTTATCTG
TTGTGTAGAATAATGATGTAGAGTTTACTAATCAGTGAGGATGTCTTGTTTTTATTTTCT
GCAAACTCTGCCTCACTTTAAAATGCATTATAACAATACCTAATTAAAGATAATTTTGGC
TCTGAAAGTTACCTTATTTTTTGTTGAGTTAGTGACTTCATTTTTCTTGCCACAATATAA
GCTTTTGAGGGATTTTTTTAAATTGGTGCTTTTAATAAGCAAATAAATCCCAGGGTTTTA
TTTTCTTCAGTGATACCCCTATAGAAACTCTTAAATGTATTTGCGCATATATATATATAT
ATTTTCTTATGCATGCTCGATGCATTTTCGTCCTGAGAAAAATGTTCTCTACAGAAACTA
CCCGTGTGTAAAAAGAAGATTGGCTTAAAATGGCTACTGTGATGGGAACAGTGTCTTAGG
GAGATGCAGCTTGGACTTGAGGTAAATTGAATACTTTACAACTGTGGTTTAGAGTTTGCT
TTAATGACATTGTATGTAAAAGGTCACATGATTGCTGTAATTTTGTATTCATTATGGTTT
CCTCAATAAATGTACATTGATGACTATTA

Protein Sequence

>8880 : length: 688
MADYSTVPPPSSGSAGGGGGGGGGGGVNDAFKDALQRARQIAAKIGGDAGTSLNSNDYGY
GGQKRPLEDGDGSWTSPSSTTHWEGMPSPFKDQPDAKKVAPQNDSFGTQLPPMHQQQSRS
VMTEEYKVPDGMVGFIIGRGGEQISRIQQESGCKIQIAPDSGGLPERSCMLTGTPESVQS
AKRLLDQIVEKGRPAPGFHHGDGPGNAVQEIMIPASKAGLVIGKGGETIKQLQERAGVKM
VMIQDGPQNTGADKPLRITGDPYKVQQAKEMVLELIRDQGGFREVRNEYGSRIGGNEGID
VPIPRFAVGIVIGRNGEMIKKIQNDAGVRIQFKPDDGTTPERIAQITGPPDRCQHAAEII
TDLLRSVQAGNPGGPGPGGRGRGRGQGNWNMGPPGGLQEFNFIVPTGKTGLIIGKGGETI
KSISQQSGARIELQRNPPPNADPNMKLFTIRGTPQQIDYARQLIEEKIGGPVNPLGPPVP
HGPHGVPGPHGPPGPPGPGTPMGPYNPAPYNPGPPGPAPHGPPAPYAPQGWGNAYPHWQQ
QAPPDPAKAGTDPNSAAWAAYYAHYYQQQAQPPPAAPAGAPTTTQTNGQGDQQNPAPAGQ
VDYTKAWEEYYKKMGQAVPAPTGAPPGGQPDYSAAWAEYYRQQAAYYAQTSPQGMPQHPP
APQCLPRPSTLGSAAKSTSAEDAASTKS