ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

8878

Name

SQSTM1

Synonym

A170|OSIL|PDB3|ZIP3|p60|p62|p62B;sequestosome 1;SQSTM1;sequestosome 1

Definition

EBI3-associated protein of 60 kDa|EBI3-associated protein p60|EBIAP|oxidative stress induced like|phosphotyrosine independent ligand for the Lck SH2 domain p62|phosphotyrosine-independent ligand for the Lck SH2 domain of 62 kDa|sequestosome-1|ubiquitin-bi

Position

5q35

Gene Type

protein-coding

Pathways and Diseases

Pathway

Signalling by NGF;Reactome;REACT:11061

Pathway

TNF receptor signaling pathway;PID Curated;200086

Pathway

p75(NTR)-mediated signaling;PID Curated;200103

Pathway

Signaling in Immune system;Reactome;REACT:6900

Pathway

p75NTR signals via NF-kB;PID Reactome;500613

Pathway

Neurotrophic factor-mediated Trk receptor signaling;PID Curated;200128

Pathway

p75NTR recruits signalling complexes;PID Reactome;500614

Pathway

NF-kB is activated and signals survival;PID Reactome;500615

Pathway

IL1-mediated signaling events;PID Curated;200075

Pathway

NRIF signals cell death from the nucleus;PID Reactome;500610

Disease

Embryoma;FunDO

Disease

Myopathy;FunDO

Disease

Neurodegenerative disorder;FunDO

Disease

Prostate cancer;FunDO

Disease

Paget disease of bone;OMIM

Disease

Psychotic disorder;FunDO

Disease

Osteitis deformans;FunDO

Disease

Breast cancer;FunDO

Disease

Alzheimer's disease;FunDO

Disease

Brain disease;FunDO

External Links

Links to cell senescence gene database

8878

Links to epithelial mesenchymal transition gene database

8878

Links to ovarian cancer gene database

8878

Links to endometrial cancer gene database

8878

Links to iHOP

8878

Sequence Information

Nucleotide Sequence

>8878 : length: 2931
GCGTCGGCTTCCGGCCGCCTTCCGCGGCCACCGCCGGGCCCGCTCCCGCCGCCGACGCCC
AGGTGCGCCAGGTGCGGGCCGGGCGGGGGTCGCGCTCACCTTTCTGGCCGCTGAGTGCCG
CGTACCAGGACAGCGAGAGGAAGGCGCACAGGCAGAAGAGCAGCAGCGTCAGGAAGGTGC
CATTGCGGAGCCTCATCTCCTCGGTGTCTGCGAGATTAATCTCTCATGGCCGCTGCACAA
GAACCTGGCTTTTAGCTGAACTAAGGAGAAAGTCCTACAACAGTTTGGCGTGCAACATGG
GGCTTGAGAAAGGATGAGGACGGGGACTTGGTTGCCTTTTCCAGTGACGAGGAATTGACA
ATGGCCATGTCCTACGTGAAGGATGACATCTTCCGAATCTACATTAAAGAGAAAAAAGAG
TGCCGGCGGGACCACCGCCCACCGTGTGCTCAGGAGGCGCCCCGCAACATGGTGCACCCC
AATGTGATCTGCGATGGCTGCAATGGGCCTGTGGTAGGAACCCGCTACAAGTGCAGCGTC
TGCCCAGACTACGACTTGTGTAGCGTCTGCGAGGGAAAGGGCTTGCACCGGGGGCACACC
AAGCTCGCATTCCCCAGCCCCTTCGGGCACCTGTCTGAGGGCTTCTCGCACAGCCGCTGG
CTCCGGAAGGTGAAACACGGACACTTCGGGTGGCCAGGATGGGAAATGGGTCCACCAGGA
AACTGGAGCCCACGTCCTCCTCGTGCAGGGGAGGCCCGCCCTGGCCCCACGGCAGAATCA
GCTTCTGGTCCATCGGAGGATCCGAGTGTGAATTTCCTGAAGAACGTTGGGGAGAGTGTG
GCAGCTGCCCTTAGCCCTCTGGGCATTGAAGTTGATATCGATGTGGAGCACGGAGGGAAA
AGAAGCCGCCTGACCCCCGTCTCTCCAGAGAGTTCCAGCACAGAGGAGAAGAGCAGCTCA
CAGCCAAGCAGCTGCTGCTCTGACCCCAGCAAGCCGGGTGGGAATGTTGAGGGCGCCACG
CAGTCTCTGGCGGAGCAGATGAGGAAGATCGCCTTGGAGTCCGAGGGGCGCCCTGAGGAA
CAGATGGAGTCGGATAACTGTTCAGGAGGAGATGATGACTGGACCCATCTGTCTTCAAAA
GAAGTGGACCCGTCTACAGGTGAACTCCAGTCCCTACAGATGCCAGAATCCGAAGGGCCA
AGCTCTCTGGACCCCTCCCAGGAGGGACCCACAGGGCTGAAGGAAGCTGCCTTGTACCCA
CATCTCCCGCCAGAGGCTGACCCGCGGCTGATTGAGTCCCTCTCCCAGATGCTGTCCATG
GGCTTCTCTGATGAAGGCGGCTGGCTCACCAGGCTCCTGCAGACCAAGAACTATGACATC
GGAGCGGCTCTGGACACCATCCAGTATTCAAAGCATCCCCCGCCGTTGTGACCACTTTTG
CCCACCTCTTCTGCGTGCCCCTCTTCTGTCTCATAGTTGTGTTAAGCTTGCGTAGAATTG
CAGGTCTCTGTACGGGCCAGTTTCTCTGCCTTCTTCCAGGATCAGGGGTTAGGGTGCAAG
AAGCCATTTAGGGCAGCAAAACAAGTGACATGAAGGGAGGGTCCCTGTGTGTGTGTGTGC
TGATGTTTCCTGGGTGCCCTGGCTCCTTGCAGCAGGGCTGGGCCTGCGAGACCCAAGGCT
CACTGCAGCGCGCTCCTGACCCCTCCCTGCAGGGGCTACGTTAGCAGCCCAGCACATAGC
TTGCCTAATGGCTTTCACTTTCTCTTTTGTTTTAAATGACTCATAGGTCCCTGACATTTA
GTTGATTATTTTCTGCTACAGACCTGGTACACTCTGATTTTAGATAAAGTAAGCCTAGGT
GTTGTCAGCAGGCAGGCTGGGGAGGCCAGTGTTGTGGGCTTCCTGCTGGGACTGAGAAGG
CTCACGAAGGGCATCCGCAATGTTGGTTTCACTGAGAGCTGCCTCCTGGTCTCTTCACCA
CTGTAGTTCTCTCATTTCCAAACCATCAGCTGCTTTTAAAATAAGATCTCTTTGTAGCCA
TCCTGTTAAATTTGTAAACAATCTAATTAAATGGCATCAGCACTTTAACCAATGACGTTT
GCATAGAGAGAAATGATTGACAGTAAGTTTATTGTTAATGGTTCTTACAGAGTATCTTTA
AAAGTGCCTTAGGGGAACCCTGTCCCTCCTAACAAGTGTATCTCGATTAATAACCTGCCA
GTCCCAGATCACACATCATCATCGAAGTCTTCCCCAGTTATAAAGAGGTCACATAGTCGT
GTGGGTCGAGGATTCTGTGCCTCCAGGACCAGGGGCCCACCCTCTGCCCAGGGAGTCCTT
GCGTCCCATGAGGTCTTCCCGCAAGGCCTCTCAGACCCAGATGTGACGGGGTGTGTGGCC
CGAGGAAGCTGGACAGCGGCAGTGGGCCTGCTGAGGCCTTCTCTTGAGGCCTGTGCTCTG
GGGGTCCCTTGCTTAGCCTGTGCTGGACCAGCTGGCCTGGGGTCCCTCTGAAGAGACCTT
GGCTGCTCACTGTCCACATGTGAACTTTTTCTAGGTGGCAGGACAAATTGCGCCCATTTA
GAGGATGTGGCTGTAACCTGCTGGATGGGACTCCATAGCTCCTTCCCAGGACCCCTCAGC
TCCCCGGCACTGCAGTCTGCAGAGTTCTCCTGGAGGCAGGGGCTGCTGCCTTGTTTCACC
TTCCATGTCAGGCCAGCCTGTCCCTGAAAGAGAAGATGGCCATGCCCTCCATGTGTAAGA
ACAATGCCAGGGCCCAGGAGGACCGCCTGCCCTGCCTGGGCCTTGGCTGGGCCTCTGGTT
CTGACACTTTCTGCTGGAAGCTGTCAGGCTGGGACAGGCTTTGATTTTGAGGGTTAGCAA
GACAAAGCAAATAAATGCCTTCCACCTCACCGCAAAAAAAAAAAAAAAAAA

Protein Sequence

>8878 : length: 440
MASLTVKAYLLGKEDAAREIRRFSFCCSPEPEAEAEAAAGPGPCERLLSRVAALFPALRP
GGFQAHYRDEDGDLVAFSSDEELTMAMSYVKDDIFRIYIKEKKECRRDHRPPCAQEAPRN
MVHPNVICDGCNGPVVGTRYKCSVCPDYDLCSVCEGKGLHRGHTKLAFPSPFGHLSEGFS
HSRWLRKVKHGHFGWPGWEMGPPGNWSPRPPRAGEARPGPTAESASGPSEDPSVNFLKNV
GESVAAALSPLGIEVDIDVEHGGKRSRLTPVSPESSSTEEKSSSQPSSCCSDPSKPGGNV
EGATQSLAEQMRKIALESEGRPEEQMESDNCSGGDDDWTHLSSKEVDPSTGELQSLQMPE
SEGPSSLDPSQEGPTGLKEAALYPHLPPEADPRLIESLSQMLSMGFSDEGGWLTRLLQTK
NYDIGAALDTIQYSKHPPPL