ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

8840

Name

WISP1

Synonym

CCN4|WISP1c|WISP1i|WISP1tc;WNT1 inducible signaling pathway protein 1;WISP1;WNT1 inducible signaling pathway protein 1

Definition

CCN family member 4|CTC-458A3.8|WNT1 induced secreted protein 1|WNT1-inducible-signaling pathway protein 1|Wnt-1 inducible signaling pathway protein 1

Position

8q24.22

Gene Type

protein-coding

External Links

Links to cell senescence gene database

8840

Links to epithelial mesenchymal transition gene database

8840

Links to ovarian cancer gene database

8840

Links to endometrial cancer gene database

8840

Links to iHOP

8840

Sequence Information

Nucleotide Sequence

>8840 : length: 5194
ATATCTGGTGCTCCTGATGGGCCGGCCAGTCTGGGCCCAGCTCCCCCGAGAGGTGGTCGG
ATCCTCTGGGCTGCTCGGTCGATGCCTGTGCCACTGACGTCCAGGCATGAGGTGGTTCCT
GCCCTGGACGCTGGCAGCAGTGACAGCAGCAGCCGCCAGCACCGTCCTGGCCACGGCCCT
CTCTCCAGCCCCTACGACCATGGACTTTACCCCAGCTCCACTGGAGGACACCTCCTCACG
CCCCCAATTCTGCAAGTGGCCATGTGAGTGCCCGCCATCCCCACCCCGCTGCCCGCTGGG
GGTCAGCCTCATCACAGATGGCTGTGAGTGCTGTAAGATGTGCGCTCAGCAGCTTGGGGA
CAACTGCACGGAGGCTGCCATCTGTGACCCCCACCGGGGCCTCTACTGTGACTACAGCGG
GGACCGCCCGAGGTACGCAATAGGAGTGTGTGCACAGGTGGTCGGTGTGGGCTGCGTCCT
GGATGGGGTGCGCTACAACAACGGCCAGTCCTTCCAGCCTAACTGCAAGTACAACTGCAC
GTGCATCGACGGCGCGGTGGGCTGCACACCACTGTGCCTCCGAGTGCGCCCCCCGCGTCT
CTGGTGCCCCCACCCGCGGCGCGTGAGCATACCTGGCCACTGCTGTGAGCAGTGGGTATG
TGAGGACGACGCCAAGAGGCCACGCAAGACCGCACCCCGTGACACAGGAGCCTTCGATGC
TGTGGGTGAGGTGGAGGCATGGCACAGGAACTGCATAGCCTACACAAGCCCCTGGAGCCC
TTGCTCCACCAGCTGCGGCCTGGGGGTCTCCACTCGGATCTCCAATGTTAACGCCCAGTG
CTGGCCTGAGCAAGAGAGCCGCCTCTGCAACTTGCGGCCATGCGATGTGGACATCCATAC
ACTCATTAAGGCAGGGAAGAAGTGTCTGGCTGTGTACCAGCCAGAGGCATCCATGAACTT
CACACTTGCGGGCTGCATCAGCACACGCTCCTATCAACCCAAGTACTGTGGAGTTTGCAT
GGACAATAGGTGCTGCATCCCCTACAAGTCTAAGACTATCGACGTGTCCTTCCAGTGTCC
TGATGGGCTTGGCTTCTCCCGCCAGGTCCTATGGATTAATGCCTGCTTCTGTAACCTGAG
CTGTAGGAATCCCAATGACATCTTTGCTGACTTGGAATCCTACCCTGACTTCTCAGAAAT
TGCCAACTAGGCAGGCACAAATCTTGGGTCTTGGGGACTAACCCAATGCCTGTGAAGCAG
TCAGCCCTTATGGCCAATAACTTTTCACCAATGAGCCTTAGTTACCCTGATCTGGACCCT
TGGCCTCCATTTCTGTCTCTAACCATTCAAATGACGCCTGATGGTGCTGCTCAGGCCCAT
GCTATGAGTTTTCTCCTTGATATCATTCAGCATCTACTCTAAAGAAAAATGCCTGTCTCT
AGCTGTTCTGGACTACACCCAAGCCTGATCCAGCCTTTCCAAGTCACTAGAAGTCCTGCT
GGATCTTGCCTAAATCCCAAGAAATGGAATCAGGTAGACTTTTAATATCACTAATTTCTT
CTTTAGATGCCAAACCACAAGACTCTTTGGGTCCATTCAGATGAATAGATGGAATTTGGA
ACAATAGAATAATCTATTATTTGGAGCCTGCCAAGAGGTACTGTAATGGGTAATTCTGAC
GTCAGCGCACCAAAACTATCCTGATTCCAAATATGTATGCACCTCAAGGTCATCAAACAT
TTGCCAAGTGAGTTGAATAGTTGCTTAATTTTGATTTTTAATGGAAAGTTGTATCCATTA
ACCTGGGCATTGTTGAGGTTAAGTTTCTCTTCACCCCTACACTGTGAAGGGTACAGATTA
GGTTTGTCCCAGTCAGAAATAAAATTTGATAAACATTCCTGTTGATGGGAAAAGCCCCCA
GTTAATACTCCAGAGACAGGGAAAGGTCAGCCCGTTTCAGAAGGACCAATTGACTCTCAC
ACTGAATCAGCTGCTGACTGGCAGGGCTTTGGGCAGTTGGCCAGGCTCTTCCTTGAATCT
TCTCCCTTGTCCTGCTTGGGGTTCATAGGAATTGGTAAGGCCTCTGGACTGGCCTGTCTG
GCCCCTGAGAGTGGTGCCCTGGAACACTCCTCTACTCTTACAGAGCCTTGAGAGACCCAG
CTGCAGACCATGCCAGACCCACTGAAATGACCAAGACAGGTTCAGGTAGGGGTGTGGGTC
AAACCAAGAAGTGGGTGCCCTTGGTAGCAGCCTGGGGTGACCTCTAGAGCTGGAGGCTGT
GGGACTCCAGGGGCCCCCGTGTTCAGGACACATCTATTGCAGAGACTCATTTCACAGCCT
TTCGTTCTGCTGACCAAATGGCCAGTTTTCTGGTAGGAAGATGGAGGTTTACCGGTTGTT
TAGAAACAGAAATAGACTTAATAAAGGTTTAAAGCTGAAGAGGTTGAAGCTAAAAGGAAA
AGGTTGTTGTTAATGAATATCAGGCTATTATTTATTGTATTAGGAAAATATAATATTTAC
TGTTAGAATTCTTTTATTTAGGGCCTTTTCTGTGCCAGACATTGCTCTCAGTGCTTTGCA
TGTATTAGCTCACTGAATCTTCACGACAATGTTGAGAAGTTCCCATTATTATTTCTGTTC
TTACAAATGTGAAACGGAAGCTCATAGAGGTGAGAAAACTCAACCAGAGTCACCCAGTTG
GTGACTGGGAAAGTTAGGATTCAGATCGAAATTGGACTGTCTTTATAACCCATATTTTCC
CCCTGTTTTTAGAGCTTCCAAATGTGTCAGAATAGGAAAACATTGCAATAAATGGCTTGA
TTTTTTAATGTCATTTTTCCCTCTTATAGTCTTTCTAGCTCCTTTTCAAAAGACGAGAAT
ATCTGATTTTCTGATAATTTAGGTGCTTAAGCATCCAAAATACATGGGACACACAAAAAT
CCAGGAATCCCCTGTAGCTTATTCCCTCTTTCCCATCGGAACCAGCTCTCATCACACATT
TAAAAGATGATTCTGTTTACCCAATGCTGCATATTGAATGTTGTGTAGTTATTCACAGGG
AATTCTGTGCAGTGTGCAGAGAGATTCCTAAACGGGAAAAGGACTGGGAATACATCCTCC
TTACTGTGACCTCCCCAAAACCTAGTCCAGTGCAAGGTATACAGTGGTGCTCATTAAATA
CTTGATGAATACAGGAAGCTGTGCATGTGTTCCTACTTTTATTCGAAGCTCTCTTCTTCC
AAAGCTACATGAAAATAGAATTTTAACAGTCAAAATTTTATATTAAGTGCCTTAGCAAAA
GAGACATTTAATATTTCAAAGAAATGCATATGTATGTATACATATATTTGTGTATGCGTA
TGCAAGAATTCTTGTATAAAGAGAATTCACTCCATGAATGATCTCTTCTGTAAGTCAGTG
TGAATCATGTTAGATTTTCTGAGAGTGAAAACACCTGCCATCTACAAATTACAAGGCTGG
ATAACAGCTCACTCCATTTGAAATTCAGTGGAAACCCAAGAGCTAGGTTCTTACTGAATT
TGCATCTCAATTTGGGAAACTGAACTTAGCTTTCAAAGATCATAGGAAGTCTGGTTGGAG
AAACTAGGGATTATTCTGGCAATGGGTGCAGGAAGGTGGTCAGAATAACCCAGTCGCCAT
TGGTTTTGAGAAACGGAACTATCTTATGCAGAGCCCGGAGGGCAAGTCTCAGACCCATGG
GTTGAAGCCATGGAGAAGGAAATTTGGATCCAATGTAATGAAGCGCTTTCTAAGTCAGAA
TTTCCCTGCAATGGTGTGGCCTGATTCAATAAAAATTAAGAATAATAAATATAATGGAAA
AAAATCTCCACTGATTGAGTGTTTACTTGGTGCCAAGCACTATGCTAAGTTGTTCATTAT
TTTATTTAATTGTTACAGCAATTTTGAGTATGCATCTTTCACTATTTTATAAGTGGAAAA
GAGAAGTGCCCCCAAAAAGTTAGAGCTCAAACAGCAGCTTATTCTACCAGCCCCTGCTCT
TGCGGAGGCCTCTGGAAAAGACCTGAATGACACCTATTGGAGAATTACATCTACAAGGGG
CTTCAAACAGACCAAATAGATCATCACCTCTGTGGTCCCTTGTTAACTATATGTTCTGAG
ACAAAGGAAAGCTACCCTAAGGGTTAGTTAACCTTTGCTGAGGAAATTTACATTCATACT
TAGAGTGAATTACTCAGGTGTGCTTAGGTGTGCAAAAGGGAAGGAGACCTGAATTCACCA
AGTTAAATCTTGCTAAACCTTATCATAAGCATTTTTTGAGCGCTTAGCATACACCAAGCC
TTGTGGAAGGTGCTTTCCTGCCATATCTCATTTAATCCTCACAGCAAACCTATAGAATAT
GGCATTATCATCTGAGTCTCACAGAAGTTTAGTCGTGTACTCAAGGTCTTACCAGCTAGT
GAACAGCAGACCAAGACTGGAAACCCAGGATAGTCTGATACCTGAGCCATCTCTTCTTGT
GCTACGCCTAGTTATTCTGTCCCCCAAATCAAAAGGCATGACCTTTATAAGAGGCGCTTT
ACTGACAATAGCTGCAATTTTAACTTTGAAAATGATTCAGAATTATCAAAGATAGTAGAT
TCGAATGACATGATTGTCTATAATCTCGCTAGCCTTGTACTGTGTGTGCATAGCAATTAC
AGGGAAGTAATCTAGCTCCTGACTATTATGTTGAACTATGTCGCTGCTTTTTACAAACTT
GTCTTGATCCAAAGCAGTCACAATGATAACCCTGCATATCTGGGAATCATAAGTCAACTA
TGTATCCCTGTGTGTGTATATATATGTATGTATGTATCTATTTTCAAACTGTGATTTAAT
ATTTAAATATTCCTACTGCCATTTTTGTGACTGAAAAACTACACATGAGGAAACGTCTTA
GAATTTTCCAATAGAGGAAAAATAACACTTGGGCAATCTGTCATGTTTCACAACAGTTCT
CATTTTTCTCATGATTTGTGTAGCGTGGAATGTGTTTGCTCAATGTGAAGGGTTTTCATT
GCTCAATTTCTCTGTGTAAGTCTTTTCCTTAAGGTAATAAACCATCAGCAAAGTCACATA
CTGGAGTTGGTGGCTTTTCTTGTACAGGCAGTTGTTATGAGACAATGATGGAGCATTGAG
CATGTTCAATAAATGTGCAGATGGTGGAAAAAAA

Protein Sequence

>8840 : length: 367
MRWFLPWTLAAVTAAAASTVLATALSPAPTTMDFTPAPLEDTSSRPQFCKWPCECPPSPP
RCPLGVSLITDGCECCKMCAQQLGDNCTEAAICDPHRGLYCDYSGDRPRYAIGVCAQVVG
VGCVLDGVRYNNGQSFQPNCKYNCTCIDGAVGCTPLCLRVRPPRLWCPHPRRVSIPGHCC
EQWVCEDDAKRPRKTAPRDTGAFDAVGEVEAWHRNCIAYTSPWSPCSTSCGLGVSTRISN
VNAQCWPEQESRLCNLRPCDVDIHTLIKAGKKCLAVYQPEASMNFTLAGCISTRSYQPKY
CGVCMDNRCCIPYKSKTIDVSFQCPDGLGFSRQVLWINACFCNLSCRNPNDIFADLESYP
DFSEIAN