ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

8811

Name

GALR2

Synonym

GAL2-R|GALNR2|GALR-2;galanin receptor 2;GALR2;galanin receptor 2

Definition

galanin receptor type 2

Position

17q25.3

Gene Type

protein-coding

Pathways and Diseases

Pathway

Signaling by GPCR;Reactome;REACT:14797

Pathway

Neuroactive ligand-receptor interaction;KEGG PATHWAY;hsa04080

Disease

Drug abuse;FunDO

Disease

Cancer;FunDO

External Links

Links to cell senescence gene database

8811

Links to epithelial mesenchymal transition gene database

8811

Links to ovarian cancer gene database

8811

Links to endometrial cancer gene database

8811

Links to iHOP

8811

Sequence Information

Nucleotide Sequence

>8811 : length: 1370
AGCGGCCGCAGCCCCGGGAGCTTCCCGCTCGCGGAGACCCAGACGGCTGCAGGAGCCCGG
GCAGCCTCGGGGTCAGCGGCACCATGAACGTCTCGGGCTGCCCAGGGGCCGGGAACGCGA
GCCAGGCGGGCGGCGGGGGAGGCTGGCACCCCGAGGCGGTCATCGTGCCCCTGCTCTTCG
CGCTCATCTTCCTCGTGGGCACCGTGGGCAACACGCTGGTGCTGGCGGTGCTGCTGCGCG
GCGGCCAGGCGGTCAGCACTACCAACCTGTTCATCCTTAACCTGGGCGTGGCCGACCTGT
GTTTCATCCTGTGCTGCGTGCCCTTCCAGGCCACCATCTACACCCTGGACGGCTGGGTGT
TCGGCTCGCTGCTGTGCAAGGCGGTGCACTTCCTCATCTTCCTCACCATGCACGCCAGCA
GCTTCACGCTGGCCGCCGTCTCCCTGGACAGGTATCTGGCCATCCGCTACCCGCTGCACT
CCCGCGAGCTGCGCACGCCTCGAAACGCGCTGGCAGCCATCGGGCTCATCTGGGGGCTGT
CGCTGCTCTTCTCCGGGCCCTACCTGAGCTACTACCGCCAGTCGCAGCTGGCCAACCTGA
CCGTGTGCCATCCCGCGTGGAGCGCCCCTCGCCGCCGCGCCATGGACATCTGCACCTTCG
TCTTCAGCTACCTGCTTCCTGTGCTGGTTCTCGGCCTGACCTACGCGCGCACCTTGCGCT
ACCTCTGGCGCGCCGTCGACCCGGTGGCCGCGGGCTCGGGTGCCCGGCGCGCCAAGCGCA
AGGTGACACGCATGATCCTCATCGTGGCCGCGCTCTTCTGCCTCTGCTGGATGCCCCACC
ACGCGCTCATCCTCTGCGTGTGGTTCGGCCAGTTCCCGCTCACGCGCGCCACTTATGCGC
TTCGCATCCTCTCGCACCTGGTCTCCTACGCCAACTCCTGCGTCAACCCCATCGTTTACG
CGCTGGTCTCCAAGCACTTCCGCAAAGGCTTCCGCACGATCTGCGCGGGCCTGCTGGGCC
GTGCCCCAGGCCGAGCCTCGGGCCGTGTGTGCGCTGCCGCGCGGGGCACCCACAGTGGCA
GCGTGTTGGAGCGCGAGTCCAGCGACCTGTTGCACATGAGCGAGGCGGCGGGGGCCCTTC
GTCCCTGCCCCGGCGCTTCCCAGCCATGCATCCTCGAGCCCTGTCCTGGCCCGTCCTGGC
AGGGCCCAAAGGCAGGCGACAGCATCCTGACGGTTGATGTGGCCTGAAAGCACTTAGCGG
GCGCGCTGGGATGTCACAGAGTTGGAGTCATTGTTGGGGGACCGTGGGGAGAGCTTTGCC
TGTTAATAAAACGCACAAACCATTTCACACACAGTGAAAAAAAAAAAAAA

Protein Sequence

>8811 : length: 387
MNVSGCPGAGNASQAGGGGGWHPEAVIVPLLFALIFLVGTVGNTLVLAVLLRGGQAVSTT
NLFILNLGVADLCFILCCVPFQATIYTLDGWVFGSLLCKAVHFLIFLTMHASSFTLAAVS
LDRYLAIRYPLHSRELRTPRNALAAIGLIWGLSLLFSGPYLSYYRQSQLANLTVCHPAWS
APRRRAMDICTFVFSYLLPVLVLGLTYARTLRYLWRAVDPVAAGSGARRAKRKVTRMILI
VAALFCLCWMPHHALILCVWFGQFPLTRATYALRILSHLVSYANSCVNPIVYALVSKHFR
KGFRTICAGLLGRAPGRASGRVCAAARGTHSGSVLERESSDLLHMSEAAGALRPCPGASQ
PCILEPCPGPSWQGPKAGDSILTVDVA