ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

8766

Name

RAB11A

Synonym

YL8;RAB11A, member RAS oncogene family;RAB11A;RAB11A, member RAS oncogene family

Definition

RAB 11A, member oncogene family|rab-11|ras-related protein Rab-11A

Position

15q22.31

Gene Type

protein-coding

Pathways and Diseases

Pathway

Endocytosis;KEGG PATHWAY;hsa04144

Pathway

Pancreatic secretion;KEGG PATHWAY;hsa04972

Pathway

Vasopressin-regulated water reabsorption;KEGG PATHWAY;hsa04962

Pathway

Thromboxane A2 receptor signaling;PID Curated;200069

Pathway

Notch signaling pathway;PID Curated;200013

Pathway

Arf6 downstream pathway;PID Curated;200079

External Links

Links to cell senescence gene database

8766

Links to epithelial mesenchymal transition gene database

8766

Links to ovarian cancer gene database

8766

Links to endometrial cancer gene database

8766

Links to iHOP

8766

Sequence Information

Nucleotide Sequence

>8766 : length: 4943
GCGGCAGGGAGGGGCTCTTCACCCAGTCCGGCAGTTGAAGCTCGGCGCTCGGGTTACCCC
TGCAGCGACGCCCCCTGGTCCCACAGATACCACTGCTGCTCCCGCCCTTTCGCTCCTCGG
CCGCGCAATGGGCACCCGCGACGACGAGTACGACTACCTCTTTAAAGTTGTCCTTATTGG
AGATTCTGGTGTTGGAAAGAGTAATCTCCTGTCTCGATTTACTCGAAATGAGTTTAATCT
GGAAAGCAAGAGCACCATTGGAGTAGAGTTTGCAACAAGAAGCATCCAGGTTGATGGAAA
AACAATAAAGGCACAGATATGGGACACAGCAGGGCAAGAGCGATATCGAGCTATAACATC
AGCATATTATCGTGGAGCTGTAGGTGCCTTATTGGTTTATGACATTGCTAAACATCTCAC
ATATGAAAATGTAGAGCGATGGCTGAAAGAACTGAGAGATCATGCTGATAGTAACATTGT
TATCATGCTTGTGGGCAATAAGAGTGATCTACGTCATCTCAGGGCAGTTCCTACAGATGA
AGCAAGAGCTTTTGCAGAAAAGAATGGTTTGTCATTCATTGAAACTTCGGCCCTAGACTC
TACAAATGTAGAAGCTGCTTTTCAGACAATTTTAACAGAGATTTACCGCATTGTTTCTCA
GAAGCAAATGTCAGACAGACGCGAAAATGACATGTCTCCAAGCAACAATGTGGTTCCTAT
TCATGTTCCACCAACCACTGAAAACAAGCCAAAGGTGCAGTGCTGTCAGAACATCTAAGG
CATTTCTCTTCTCCCCTAGAAGGCTGTGTATAGTCCATTTCCCAGGTCTGAGATTTAAAT
ATATTTGTAATTCTTGTGTCACTTTTGTGTTTTATTACTTCATACTTATGAATTTTTCCA
TGTCCTAAGTCTTTTGATTTTAGCTTTATAAAATCATCCACTTGTCCCGAATGACTGCAG
CTTTTTTTCATGCTATGGCTTCACTAGCCTTAGTTTAATAAACTGAATGTTTGGATTCCT
CAGTTATTGTTTACTTTTCATCATGGAAGCCTGTCACTGTATGTAGGACATAATAGAACT
TGATCACTTGAAGCTCAGACCTATTGGTCTTGATCAAATCAAACTAAGAAGACCTTAGAA
ATAAGCTACCATTTTGCCACAGAGCAGCTTATAGGTAATACACTCTTCTCTCAGTGCAGT
GTACATTTCCACAAATCTAAGAATTGCCCTATAAACATAGCAGGATTTTGAGAGCTTGAA
AATTTTCCATTATTCTGGACATGAATTTCTAAAATGCCTTAATAGGTTTATGTAGTTGAG
TAAATTTTGTTTTTTAATTTTTGTAAGCATCAAAGTTGATTAGAGAGGGGGGCACTTTTT
CTGGAGAATTCTCTTAGTAAACACAAAAGATTGTTACGGTTTCATTAGTAGTATGGTTGT
GGGGCCATAAGTTAAACAGTGCTGCCTGGTAGGCTGGGAACTGAAGAGACTTGTGGTATT
CCATCTCGGGTGCCTCTGTTGGCAATGATCAGGCAGCCCAAAAGATTTAAATGATCTATA
ATAATTTCCAAGCGGTAGATTATGTGGCATTTTATTGCTCAGGCAATAATTGGTTTAATG
CTGGTAGTGTCAAATTTTGAAGTGTTAATTTTGTCTTAGAACCTTCCAGTAAGTGAAATA
CAACCTAGTTTTATCACCATATCCACCAGCAGGCATGGATAATTATTTTAACAATGCTAA
TATTTGAGTTTTGCAGTATATTATAGAATATAGTCCAGTTAAATCTTTGGTTTCAGTATG
TCTGAAGAGTACAGTGAGAGGTTAATTTCTGCTCAAGTGGTACCACTTAAAGGCATGTAT
TCTTTTAGTATGTAAAATGAAATAGTACCTTGAGTTTAAATAGAATGCATTTAGGCATTG
TAGAGATCTGAAATAGTTTTCTTCCACTACATTGTTGAAATCAATGAAGCAATTAGTTTC
TCATTCAGAAATGTGCACACTAATATTTAGTTTTGCTTTCTCGTGGATAATATTAAGCAC
TTACTCTGCAGTTTCCTGGAAGTTGTGTCAACTGCAGTGATACTATTCAGGATGGTGGGA
AATCCCCAAAAATATGTATGTGTGGGCTTGCTTAGATTACTATATTTCATAGTTAATCTT
TTGTCTCTTGCGGTGCTCATGATGTGTGGGGCACACGGAAGGCATTGCTGTAGTCAGTCA
TTTTGGTTTTCTTCTATAGCCATTTTATTATTTTAGTGTATTAGTTATGAAGATAATATT
ATCTATTTGTAAATTGCTACTTTGTATTTTATGCATGCTCTGTAATTTGATTTTTTTTTA
GTTATTGATTTGGATTATATTCACATTCTAATAAACAGTTATAGGGGGATTATTTCTTAT
GCTGTCAGATTACATTTTTCCTTTGAGTGCTTTGGGTGCAGCCGTGGAATCCTGATGTAA
AAGCATAGGTTCTTGCATTACTGAGTAAACATTGAATTGGGAGCATCAGTGTGTGAATTC
AGCTTTGATTTTAGAACTGCAGTTCAATTATGCTTTCCTTGGAAAAAGTATGTCCAAAAA
CATTAGGAAAGTAGTGTGTATTTTCATATATAACAGTGTCACCAGACCCAGGAAAAGAAA
CCATCTCTATTTTATTGAAAGTTGGTGGTAGATTTTTTACAAAGTAAGGAGAAAAGAGAA
AAACTAAATAGTGAATTGAAAATGAATAAAGTAAACTTAGAATTTTTACCCAAGTGTAGA
CTTAAATGTTGCTTTGAGTATGGCTGGATCTTGGGAGAATTCCAGGAAATATTAGGTATT
AGAAAATGACTTTGATTGCATTTCAGCAGGTGTCTTTATTCTGAGTAGTATCTTAGGAGA
CAAACTGTCTCAAGCAAGAAACAATAAATTTTTAAATATTATGACAGTTCAGGGCTTAAG
GCAGTTTAGAAGTATTTTGCTACTTGACCTTGATTTTCAGTTATTTTAACTTTGAATTTT
TTTTTTTTTTTTTGAGACGGAGTCTTGCTCTGTTGCCCAGGCTGGAGTACAATGGCACCA
TCTCAGCTCACTGCAAGCTCCACCTCCAGGGTTCATGCCATTCTCCTGCCTCAGCCTCCC
GAGTAGCTGGGATTATAGGCGCCAGCCACCACGACTGGCTAATTTTTTGTATTTTTAGTA
GAGACGGGGTTTCACCATGTTAGCCAGGGTGGTCTCGATCTCCTGACCTGGTGATACACC
CACCTCGGCCTCCCAAAGTGCTGGGATTAAAGGCGTGAGCCACCGTGCCTGGCCTTGAAT
TTTTTTTTAACCTGTTATATAGTCTCCTGAATAGTTAGCCATGGTGCCTTGATTTAATCT
TATGTCATTGTTCTCAAATGCCATGATTTCTCTTTAATAGTAGTTGTCATTATGTAAGGG
TAAGTTATTGCCCATTTAATTGTAATTATAAGAAGAGGTGCCAGCTAGTGACCTTACATC
AGTGATCTTTTAAGTTCTGAAGGGTTCTGCAGAAAAGTTACACTTCTTGAGTTTGGGTTG
CCCATCAGAGCTGGTCACATTTCTTTGATCATTGAAAAAATGAATATCTTAATTTTTGTC
TTTGCTGACTGGTATTTATAAAATACAAATGCTTTTAGTGGGTTGAGCTGTTGTGATAAT
CTCTTCCATCTACCTTAGAGAAGAAGCTGTACTATTTAGACAGTTTTGGCCAACACTAGA
AGCAAAAGAATTCAAAGGCTGGGTGGATATTTAAGAACTTATTCTAACCTGTCAGGTTTC
AATTTGTGGGGCTTGGTTTAACAGAGGAAAAAAATATAAATTGATTTTCTGATGTCTCAC
AAATATCACATACCTGGAAAAAAATTAAAACAAAAAATGAATTTTGTAAAAGGTTATGTA
TGACTTCCATTTGCTCTGTAAAAAAATGAACAAAGATTGTGAAAGGATCCTCTTCCACCA
CATCATTTAATGGGTTAGCGGAACAGATAGGGAGCTATGACACTAGCACCAAAGAGAGAT
TTTTCTTCTGGTTGGGTGGTGCTGGTGCCACGCCCCTTTCTGGGATTTGACAAGTCTTTC
CCACTCACCTATACAATATGCCAAATCAACTGGAGTTGTCATTCTAATGTTTTAAAGAAT
GATTGGGTTCCCCCAAACTGTAGGAGGTCGATGGTAACAATAAAGTGATACAAAATGCTT
ATGTCATTATAATTTATGTAAGGGAGACCATTAGGCTGAGAATCAATATGATTGAGGTTA
TCTATTCTCCTGAAAAGTGAATTGGAGAATAAAGAAAGAATATTTGAAAGGATGTTGTGT
ACTAGGCAATATACTAGCATGTATTAGAAAATACGGTAAACTGTGGGTTAGAAGAGTGAA
AGTAGCTGGTATGATAGAGCACTGGACTGAGTAACGAAGAGATTCTAGTCATGGCTCTTG
TGGTCATTTCATTTTTGAGCCTCACATTCTTCCAATTAATGAGGGTACCAGATTAAATAA
ACTCTGGGGATTCATCCCAATTCGAACTCTGTAATTCTCTGAATGAACTCTCTCTTCAAT
TAAAGCCAAATTATTAACATTTTAACTCAAGTTTAAATTTAATAGAGAAGTCAAAATGAG
GTATGCACTTTGTGGAATGTTTTTGGTCTTATCACAATAACCTGATTAAAATGGTGCCTT
TATTTCCATGTTTACTCCTTTAAATAAGATGAAAGCTTTCAGAACATTTATTTGCAAAAT
GACTGTCAATATCAACAATATGCATCAAAGTACCATATATGCTAAGGGAGAGGAGCACTT
GATGGGCTGCTATGTTAACTGTAAATTGAGAACTGCTTGTTTTATGGCTTTTGCTGTTAA
AAAAAAACTGCTGGCTTTTAATATGTACTTTAAAATATACTCATGTCTGGGAGAGAACTT
TTAAAAACAAAAAAAAAAAAAAA

Protein Sequence

>8766 : length: 216
MGTRDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTI
KAQIWDTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADSNIVIM
LVGNKSDLRHLRAVPTDEARAFAEKNGLSFIETSALDSTNVEAAFQTILTEIYRIVSQKQ
MSDRRENDMSPSNNVVPIHVPPTTENKPKVQCCQNI