ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

8754

Name

ADAM9

Synonym

CORD9|MCMP|MDC9|Mltng;ADAM metallopeptidase domain 9;ADAM9;ADAM metallopeptidase domain 9

Definition

ADAM metallopeptidase domain 9 (meltrin gamma)|cellular disintegrin-related protein|cone rod dystrophy 9|disintegrin and metalloproteinase domain-containing protein 9|metalloprotease/disintegrin/cysteine-rich protein 9|myeloma cell metalloproteinase

Position

8p11.22

Gene Type

protein-coding

Pathways and Diseases

Pathway

Alzheimer disease-amyloid secretase pathway;PANTHER;P00003

Disease

Cone-rod dystrophy 9;OMIM

External Links

Links to cell senescence gene database

8754

Links to epithelial mesenchymal transition gene database

8754

Links to ovarian cancer gene database

8754

Links to endometrial cancer gene database

8754

Links to iHOP

8754

Sequence Information

Nucleotide Sequence

>8754 : length: 4111
CGGCAGGGTTGGAAAATGATGGAAGAGGCGGAGGTGGAGGCGACCGAGTGCTGAGAGGAA
CCTGCGGAATCGGCCGAGATGGGGTCTGGCGCGCGCTTTCCCTCGGGGACCCTTCGTGTC
CGGTGGTTGCTGTTGCTTGGCCTGGTGGGCCCAGTCCTCGGTGCGGCGCGGCCAGGCTTT
CAACAGACCTCACATCTTTCTTCTTATGAAATTATAACTCCTTGGAGATTAACTAGAGAA
AGAAGAGAAGCCCCTAGGCCCTATTCAAAACAAGTATCTTATGTTATTCAGGCTGAAGGA
AAAGAGCATATTATTCACTTGGAAAGGAACAAAGACCTTTTGCCTGAAGATTTTGTGGTT
TATACTTACAACAAGGAAGGGACTTTAATCACTGACCATCCCAATATACAGAATCATTGT
CATTATCGGGGCTATGTGGAGGGAGTTCATAATTCATCCATTGCTCTTAGCGACTGTTTT
GGACTCAGAGGATTGCTGCATTTAGAGAATGCGAGTTATGGGATTGAACCCCTGCAGAAC
AGCTCTCATTTTGAGCACATCATTTATCGAATGGATGATGTCTACAAAGAGCCTCTGAAA
TGTGGAGTTTCCAACAAGGATATAGAGAAAGAAACTGCAAAGGATGAAGAGGAAGAGCCT
CCCAGCATGACTCAGCTACTTCGAAGAAGAAGAGCTGTCTTGCCACAGACCCGGTATGTG
GAGCTGTTCATTGTCGTAGACAAGGAAAGGTATGACATGATGGGAAGAAATCAGACTGCT
GTGAGAGAAGAGATGATTCTCCTGGCAAACTACTTGGATAGTATGTATATTATGTTAAAT
ATTCGAATTGTGCTAGTTGGACTGGAGATTTGGACCAATGGAAACCTGATCAACATAGTT
GGGGGTGCTGGTGATGTGCTGGGGAACTTCGTGCAGTGGCGGGAAAAGTTTCTTATCACA
CGTCGGAGACATGACAGTGCACAGCTAGTTCTAAAGAAAGGTTTTGGTGGAACTGCAGGA
ATGGCATTTGTGGGAACAGTGTGTTCAAGGAGCCACGCAGGCGGGATTAATGTGTTTGGA
CAAATCACTGTGGAGACATTTGCTTCCATTGTTGCTCATGAATTGGGTCATAATCTTGGA
ATGAATCACGATGATGGGAGAGATTGTTCCTGTGGAGCAAAGAGCTGCATCATGAATTCA
GGAGCATCGGGTTCCAGAAACTTTAGCAGTTGCAGTGCAGAGGACTTTGAGAAGTTAACT
TTAAATAAAGGAGGAAACTGCCTTCTTAATATTCCAAAGCCTGATGAAGCCTATAGTGCT
CCCTCCTGTGGTAATAAGTTGGTGGACGCTGGGGAAGAGTGTGACTGTGGTACTCCAAAG
GAATGTGAATTGGACCCTTGCTGCGAAGGAAGTACCTGTAAGCTTAAATCATTTGCTGAG
TGTGCATATGGTGACTGTTGTAAAGACTGTCGGTTCCTTCCAGGAGGTACTTTATGCCGA
GGAAAAACCAGTGAGTGTGATGTTCCAGAGTACTGCAATGGTTCTTCTCAGTTCTGTCAG
CCAGATGTTTTTATTCAGAATGGATATCCTTGCCAGAATAACAAAGCCTATTGCTACAAC
GGCATGTGCCAGTATTATGATGCTCAATGTCAAGTCATCTTTGGCTCAAAAGCCAAGGCT
GCCCCCAAAGATTGTTTCATTGAAGTGAATTCTAAAGGTGACAGATTTGGCAATTGTGGT
TTCTCTGGCAATGAATACAAGAAGTGTGCCACTGGGAATGCTTTGTGTGGAAAGCTTCAG
TGTGAGAATGTACAAGAGATACCTGTATTTGGAATTGTGCCTGCTATTATTCAAACGCCT
AGTCGAGGCACCAAATGTTGGGGTGTGGATTTCCAGCTAGGATCAGATGTTCCAGATCCT
GGGATGGTTAACGAAGGCACAAAATGTGGTGCTGGAAAGATCTGTAGAAACTTCCAGTGT
GTAGATGCTTCTGTTCTGAATTATGACTGTGATGTTCAGAAAAAGTGTCATGGACATGGG
GTATGTAATAGCAATAAGAATTGTCACTGTGAAAATGGCTGGGCTCCCCCAAATTGTGAG
ACTAAAGGATACGGAGGAAGTGTGGACAGTGGACCTACATACAATGAAATGAATACTGCA
TTGAGGGACGGACTTCTGGTCTTCTTCTTCCTAATTGTTCCCCTTATTGTCTGTGCTATT
TTTATCTTCATCAAGAGGGATCAACTGTGGAGAAGCTACTTCAGAAAGAAGAGATCACAA
ACATATGAGTCAGATGGCAAAAATCAAGCAAACCCTTCTAGACAGCCGGGGAGTGTTCCT
CGACATGTTTCTCCAGTGACACCTCCCAGAGAAGTTCCTATATATGCAAACAGATTTGCA
GTACCAACCTATGCAGCCAAGCAACCTCAGCAGTTCCCATCAAGGCCACCTCCACCACAA
CCGAAAGTATCATCTCAGGGAAACTTAATTCCTGCCCGTCCTGCTCCTGCACCTCCTTTA
TATAGTTCCCTCACTTGATTTTTTTAACCTTCTTTTTGCAAATGTCTTCAGGGAACTGAG
CTAATACTTTTTTTTTTTCTTGATGTTTTCTTGAAAAGCCTTTCTGTTGCAACTATGAAT
GAAAACAAAACACCACAAAACAGACTTCACTAACACAGAAAAACAGAAACTGAGTGTGAG
AGTTGTGAAATACAAGGAAATGCAGTAAAGCCAGGGAATTTACAATAACATTTCCGTTTC
CATCATTGAATAAGTCTTATTCAGTCATCGGTGAGGTTAATGCACTAATCATGGATTTTT
TGAACATGTTATTGCAGTGATTCTCAAATTAACTGTATTGGTGTAAGATTTTTGTCATTA
AGTGTTTAAGTGTTATTCTGAATTTTCTACCTTAGTTATCATTAATGTAGTTCCTCATTG
AACATGTGATAATCTAATACCTGTGAAAACTGACTAATCAGCTGCCAATAATATCTAATA
TTTTTCATCATGCACGAATTAATAATCATCATACTCTAGAATCTTGTCTGTCACTCACTA
CATGAATAAGCAAATATTGTCTTCAAAAGAATGCACAAGAACCACAATTAAGATGTCATA
TTATTTTGAAAGTACAAAATATACTAAAAGAGTGTGTGTGTATTCACGCAGTTACTCGCT
TCCATTTTTATGACCTTTCAACTATAGGTAATAACTCTTAGAGAAATTAATTTAATATTA
GAATTTCTATTATGAATCATGTGAAAGCATGACATTCGTTCACAATAGCACTATTTTAAA
TAAATTATAAGCTTTAAGGTACGAAGTATTTAATAGATCTAATCAAATATGTTGATTCAT
GGCTATAATAAAGCAGGAGCAATTATAAAATCTTCAATCAATTGAACTTTTACAAAACCA
CTTGAGAATTTCATGAGCACTTTAAAATCTGAACTTTCAAAGCTTGCTATTAAATCATTT
AGAATGTTTACATTTACTAAGGTGTGCTGGGTCATGTAAAATATTAGACACTAATATTTT
CATAGAAATTAGGCTGGAGAAAGAAGGAAGAAATGGTTTTCTTAAATACCTACAAAAAAG
TTACTGTGGTATCTATGAGTTATCATCTTAGCTGTGTTAAAAATGAATTTTTACTATGGC
AGATATGGTATGGATCGTAAAATTTTAAGCACTAAAAATTTTTTCATAACCTTTCATAAT
AAAGTTTAATAATAGGTTTATTAACTGAATTTCATTAGTTTTTTAAAAGTGTTTTTGGTT
TGTGTATATATACATATACAAATACAACATTTACAATAAATAAAATACTTGAAATTCTCT
TTTGTGTCTCCTAGTAGCTTCCTACTCAACTATTTATAATCTCATTAATTAAAAAGTTAT
AATTTTAGATAAAAATTCTAGTCAAATTTTTACAGATATTATCTCACTAATTTTCAGACT
TTTGCCAAAGTGTGCACAATGGCTTTTTGTTAATAAAGAACAGATTAGTTTTGAAGAAGG
CAAAAATTTCAGTTTTCTGAAGACAGCATGTTATTTTAACAATCAAGTATACATATTAAA
AATTGTGAGCAATCTCAAAAAAAAAAAAAAA

Protein Sequence

>8754 : length: 819
MGSGARFPSGTLRVRWLLLLGLVGPVLGAARPGFQQTSHLSSYEIITPWRLTRERREAPR
PYSKQVSYVIQAEGKEHIIHLERNKDLLPEDFVVYTYNKEGTLITDHPNIQNHCHYRGYV
EGVHNSSIALSDCFGLRGLLHLENASYGIEPLQNSSHFEHIIYRMDDVYKEPLKCGVSNK
DIEKETAKDEEEEPPSMTQLLRRRRAVLPQTRYVELFIVVDKERYDMMGRNQTAVREEMI
LLANYLDSMYIMLNIRIVLVGLEIWTNGNLINIVGGAGDVLGNFVQWREKFLITRRRHDS
AQLVLKKGFGGTAGMAFVGTVCSRSHAGGINVFGQITVETFASIVAHELGHNLGMNHDDG
RDCSCGAKSCIMNSGASGSRNFSSCSAEDFEKLTLNKGGNCLLNIPKPDEAYSAPSCGNK
LVDAGEECDCGTPKECELDPCCEGSTCKLKSFAECAYGDCCKDCRFLPGGTLCRGKTSEC
DVPEYCNGSSQFCQPDVFIQNGYPCQNNKAYCYNGMCQYYDAQCQVIFGSKAKAAPKDCF
IEVNSKGDRFGNCGFSGNEYKKCATGNALCGKLQCENVQEIPVFGIVPAIIQTPSRGTKC
WGVDFQLGSDVPDPGMVNEGTKCGAGKICRNFQCVDASVLNYDCDVQKKCHGHGVCNSNK
NCHCENGWAPPNCETKGYGGSVDSGPTYNEMNTALRDGLLVFFFLIVPLIVCAIFIFIKR
DQLWRSYFRKKRSQTYESDGKNQANPSRQPGSVPRHVSPVTPPREVPIYANRFAVPTYAA
KQPQQFPSRPPPPQPKVSSQGNLIPARPAPAPPLYSSLT