ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

8725

Name

URI1

Synonym

C19orf2|NNX3|PPP1R19|RMP|URI;URI1, prefoldin-like chaperone;URI1;URI1, prefoldin-like chaperone

Definition

RNA polymerase II subunit 5-mediating protein|RPB5-mediating protein|protein phosphatase 1 regulatory subunit 19|protein phosphatase 1, regulatory subunit 19|unconventional prefoldin RPB5 interactor 1

Position

19q12

Gene Type

protein-coding

External Links

Links to cell senescence gene database

8725

Links to epithelial mesenchymal transition gene database

8725

Links to ovarian cancer gene database

8725

Links to endometrial cancer gene database

8725

Links to iHOP

8725

Sequence Information

Nucleotide Sequence

>8725 : length: 3460
GTGTGGGGAGGCGCGGCCGCCACGCGACGCCTGGCTGGGCCCGCACCGGAGAGGCGTCTC
GGTACCTGGCAGGCGGCCTGCTACTCGGAGCCCGCTGCGGGGCGGCGGCGGCGGGGACAT
GCACGTGTGAGATGCGGCAGCGGGCGGCGCGGACGCGAACAGCAGCGGCGGCGGCGGGCG
CGGCCTCCTGGGCGCGGGGCGCGCGGTGCCTGAGGGCGGGCGCGCGGGCGCTGGGCAACT
GCCGGCCGCGCCGCCTGCGCAGGCGCTGGTTCAGGACTCACACGCCGCGCTGAGGCCCGC
GGGCCCGTCATGGAGGCGCCCACCGTGGAGACGCCCCCCGACCCCTCGCCCCCTTCGGCC
CCGGCCCCTGCCCTGGTTCCGTTGCGCGCCCCGGATGTGGCGCGGCTGCGCGAGGAGCAG
GAAAAGGTGGTCACTAACTGCCAAGAGAGAATCCAGCATTGGAAGAAGGTAGATAATGAC
TATAATGCCCTTCGAGAAAGACTCAGCACCTTGCCTGATAAATTGTCTTATAATATAATG
GTACCATTTGGCCCTTTTGCCTTCATGCCAGGAAAACTTGTCCATACTAATGAAGTCACT
GTTTTACTGGGGGACAACTGGTTTGCAAAGTGCTCAGCAAAGCAGGCTGTAGGTTTAGTT
GAGCACCGGAAAGAACATGTAAGAAAAACAATAGATGACTTAAAAAAAGTGATGAAAAAT
TTTGAATCCAGAGTTGAATTCACAGAAGATTTGCAGAAAATGAGCGATGCTGCAGGTGAT
ATTGTTGACATACGAGAAGAAATTAAATGTGACTTCGAATTTAAAGCAAAACACCGAATT
GCTCATAAACCGCATTCCAAACCAAAAACTTCAGATATTTTTGAAGCAGATATTGCAAAT
GATGTGAAATCCAAGGATTTGCTAGCTGATAAAGAACTGTGGGCTCGACTTGAAGAACTA
GAGAGACAGGAAGAATTGCTGGGTGAACTTGATAGTAAGCCTGATACTGTGATTGCAAAT
GGAGAAGATACGACATCTTCTGAAGAGGAAAAGGAAGATCGTAACACAAATGTGAATGCG
ATGCATCAAGTAACAGACTCTCATACTCCTTGTCATAAGGATGTTGCAAGTTCAGAACCA
TTCAGTGGTCAAGTGAATAGTCAGTTGAACTGTTCAGTGAATGGTTCCAGTTCTTACCAC
AGTGATGATGATGATGATGATGATGATGACGACGACGACGACAACATTGACGACGATGAT
GGTGATAACGACCATGAGGCTTTAGGGGTTGGAGATAATTCTATACCAACAATATATTTT
TCACATACTGTTGAGCCTAAGAGGGTCCGAATAAATACTGGAAAGAATACCACTTTAAAA
TTCAGTGAAAAGAAAGAAGAAGCCAAACGTAAACGAAAGAACAGCACTGGCAGTGGCCAC
TCTGCCCAGGAGCTGCCGACCATCAGGACGCCTGCAGACATTTACAGAGCCTTTGTTGAT
GTTGTGAATGGAGAATATGTCCCTCGCAAATCCATCCTGAAGTCTCGAAGTAGAGAGAAT
AGTGTGTGTAGCGACACTAGTGAAAGCAGTGCTGCTGAATTTGATGATAGGCGGGGAGTT
TTGAGGAGTATCAGCTGCGAAGAAGCCACTTGCAGTGACACCAGTGAGAGCATTTTGGAA
GAGGAACCACAAGAAAATCAAAAGAAACTTTTGCCCTTATCAGTAACACCTGAGGCTTTT
TCTGGAACTGTTATAGAAAAAGAATTTGTATCACCTTCCTTAACACCACCCCCAGCCATT
GCTCATCCCGCACTACCCACTATTCCAGAACGAAAGGAAGTTCTGTTGGAAGCATCTGAA
GAAACTGGAAAGAGGGTTTCAAAGTTTAAAGCTGCCAGATTGCAACAGAAAGACTAGGCC
CTGTCTAGGAAATGGGAATTTACATCCTAAAACCTAGTTGTTCATTTGTTTAGAGTATCT
ATAGCAAAATAGGTTACATGTAGTTTGAAATAAGGTATCCTGAGTTACTTTGGCAACAAG
TTCTTTTACCCTTACCCGTGGTATTTGAAAAAAATCAAGGTAACTGTCTGAATACTTTAA
TATCAGCTTGTTTTGTGAATTCTCTGAATACTGTCAACACTCTTATCTAAGTTTGCCTTT
ATGATGCAGTGGCAGCATTTTGAATTACTTTTCAAAGAATACTGTTCATATGCATTGTTT
TTGTGTTTCAAACTAAATACAGGCAGTTTTGTGCCAGCTGTGATATTGTGCATACCATAT
GGACCATTTTAAAGAAAATTTTAAAATTTCAAATAGATTCAACAATTACATTACTTGCTT
TCACATTTTAAAGGCACTTTAAAAAAATCTACTTCTCTTGTAGGTTTTGCGGCTAGTTGG
CTATTCAAGAAACCTCGCCCCTCTGAATGTCATACTGTAATCTTTAAGGAAGAAAGCTAC
ATGAATTAATTGTACTCTATGGGAAAATTTCTTTGGAAAGATATTTTGTAAAACTTTTTT
TTCCAAGTAAAAACTTTATGAAACTTGGTCTCAAAAATGTTGTGAACTTTATGATTCAAA
ATTGAGTACAGATATGTCCTTGATTCATATGTATGCTACATGTATCACACAACAGATCTG
GAATTCTTTCAGTTCCTCAGATACTTCTCCCTTAGTTTTTGCAGTTTCACTGGGATTATG
TTTTGGGAAACAAGGAAAGGTCTAGATGCTTAAACATTTTAAATAAAAATTCCTTACAGT
TTCATCTTCCCAACATTTTCATTCTTTAAGGCTACTTTCCTACTAACTGAAATAACACAT
TTACTTTTACCACAATTCCTCAAAATAAATTTATTCTAACATTGAAAATAACATTACAAG
TTAATCATTAGCTTGATGCATGCTAAAATGTAGCTTTTAAAAAGCATTCTGCATTAGTAC
TAAAATAAGCCATCAATGCCAGTCCACCCTCTCTATTCATGGCTAAATATTTAAAGGTTA
TTTATAGCTTCTTTAATGAATTCTTCTTAAACAAAGTGAAATTATGTCCTAGAAAAGTAG
AAGCTATTCGTAACTAGAGCAGTGCAACTTTAAAGTTTTATGAATATGTATTTTAATGAC
AAGGGGGCGAGCTTGCATCCCCACTAGTTAATGGATAATTCAAACCGAGGACTGATTTTG
AAAGATCACCTAAAAATGTAGATTTGTTCTTTAGTAAATTTAGATCAACTATGCATATAT
TTTGTAGGTAAATCTTTCAGTCCATGCCCCAACCCTCACCAAAACCAAAGCAGAAATTAC
ACACACAAAGATGCTCCCGTTAGGAATTGCTATTCACATGAGGCTTTCTGTGCTAGATTT
TTTTCTCAGAAACAAACTTTACTGTAGGACTATTGTGGTGTTCTTAACAGATTTGTAATT
TCAAGATGCGTGTCATTAAATAATTTTTCATGTTCACAGA

Protein Sequence

>8725 : length: 535
MEAPTVETPPDPSPPSAPAPALVPLRAPDVARLREEQEKVVTNCQERIQHWKKVDNDYNA
LRERLSTLPDKLSYNIMVPFGPFAFMPGKLVHTNEVTVLLGDNWFAKCSAKQAVGLVEHR
KEHVRKTIDDLKKVMKNFESRVEFTEDLQKMSDAAGDIVDIREEIKCDFEFKAKHRIAHK
PHSKPKTSDIFEADIANDVKSKDLLADKELWARLEELERQEELLGELDSKPDTVIANGED
TTSSEEEKEDRNTNVNAMHQVTDSHTPCHKDVASSEPFSGQVNSQLNCSVNGSSSYHSDD
DDDDDDDDDDDNIDDDDGDNDHEALGVGDNSIPTIYFSHTVEPKRVRINTGKNTTLKFSE
KKEEAKRKRKNSTGSGHSAQELPTIRTPADIYRAFVDVVNGEYVPRKSILKSRSRENSVC
SDTSESSAAEFDDRRGVLRSISCEEATCSDTSESILEEEPQENQKKLLPLSVTPEAFSGT
VIEKEFVSPSLTPPPAIAHPALPTIPERKEVLLEASEETGKRVSKFKAARLQQKD