ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

868

Name

CBLB

Synonym

Cbl-b|Nbla00127|RNF56;Cbl proto-oncogene B, E3 ubiquitin protein ligase;CBLB;Cbl proto-oncogene B, E3 ubiquitin protein ligase

Definition

Cas-Br-M (murine) ecotropic retroviral transforming sequence b|Cas-Br-M (murine) ectropic retroviral transforming sequence b|Cbl proto-oncogene, E3 ubiquitin protein ligase B|E3 ubiquitin-protein ligase CBL-B|RING finger protein 56|SH3-binding protein CBL

Position

3q13.11

Gene Type

protein-coding

Pathways and Diseases

Pathway

Bacterial invasion of epithelial cells;KEGG PATHWAY;hsa05100

Pathway

Endocytosis;KEGG PATHWAY;hsa04144

Pathway

Insulin signaling pathway;KEGG PATHWAY;hsa04910

Pathway

Jak-STAT signaling pathway;KEGG PATHWAY;hsa04630

Pathway

Chronic myeloid leukemia;KEGG PATHWAY;hsa05220

Pathway

T cell receptor signaling pathway;KEGG PATHWAY;hsa04660

Pathway

ErbB signaling pathway;KEGG PATHWAY;hsa04012

Pathway

Ubiquitin mediated proteolysis;KEGG PATHWAY;hsa04120

Pathway

Fc-epsilon receptor I signaling in mast cells;PID Curated;200003

Pathway

Internalization of ErbB1;PID Curated;200146

Pathway

EGF receptor signaling pathway;PANTHER;P00018

Pathway

CD40/CD40L signaling;PID Curated;200031

Pathway

Pathways in cancer;KEGG PATHWAY;hsa05200

Pathway

Calcineurin-regulated NFAT-dependent transcription in lymphocytes;PID Curated;200039

Disease

Autoimmune disease;FunDO

Disease

Diabetes mellitus;FunDO

Disease

diabetes, type 1;GAD

Disease

Muscular atrophy;FunDO

Disease

IMMUNE;GAD

Disease

Leukemia;FunDO

Disease

Multiple sclerosis;NHGRI

External Links

Links to cell senescence gene database

868

Links to epithelial mesenchymal transition gene database

868

Links to ovarian cancer gene database

868

Links to endometrial cancer gene database

868

Links to iHOP

868

Sequence Information

Nucleotide Sequence

>868 : length: 6600
GCTGTCCTGGGTAGAAGGGTTTGGCAGCCCTAGGGAGATGAATTTCTCCAGCGTTGGACC
CGCCCAGAGCGGAGAAGCAACACCCTTCCAGCCACTACTCTGTTGCTATGAAACAAAAGA
CTAGGAAGAACTAAAATTCCAGATGGCAAACTCAATGAATGGCAGAAACCCTGGTGGTCG
AGGAGGAAATCCCCGAAAAGGTCGAATTTTGGGTATTATTGATGCTATTCAGGATGCAGT
TGGACCCCCTAAGCAAGCTGCCGCAGATCGCAGGACCGTGGAGAAGACTTGGAAGCTCAT
GGACAAAGTGGTAAGACTGTGCCAAAATCCCAAACTTCAGTTGAAAAATAGCCCACCATA
TATACTTGATATTTTGCCTGATACATATCAGCATTTACGACTTATATTGAGTAAATATGA
TGACAACCAGAAACTTGCCCAACTCAGTGAGAATGAGTACTTTAAAATCTACATTGATAG
CCTTATGAAAAAGTCAAAACGGGCAATAAGACTCTTTAAAGAAGGCAAGGAGAGAATGTA
TGAAGAACAGTCACAGGACAGACGAAATCTCACAAAACTGTCCCTTATCTTCAGTCACAT
GCTGGCAGAAATCAAAGCAATCTTTCCCAATGGTCAATTCCAGGGAGATAACTTTCGTAT
CACAAAAGCAGATGCTGCTGAATTCTGGAGAAAGTTTTTTGGAGACAAAACTATCGTACC
ATGGAAAGTATTCAGACAGTGCCTTCATGAGGTCCACCAGATTAGCTCTGGCCTGGAAGC
AATGGCTCTAAAATCAACAATTGATTTAACTTGCAATGATTACATTTCAGTTTTTGAATT
TGATATTTTTACCAGGCTGTTTCAGCCTTGGGGCTCTATTTTGCGGAATTGGAATTTCTT
AGCTGTGACACATCCAGGTTACATGGCATTTCTCACATATGATGAAGTTAAAGCACGACT
ACAGAAATATAGCACCAAACCCGGAAGCTATATTTTCCGGTTAAGTTGCACTCGATTGGG
ACAGTGGGCCATTGGCTATGTGACTGGGGATGGGAATATCTTACAGACCATACCTCATAA
CAAGCCCTTATTTCAAGCCCTGATTGATGGCAGCAGGGAAGGATTTTATCTTTATCCTGA
TGGGAGGAGTTATAATCCTGATTTAACTGGATTATGTGAACCTACACCTCATGACCATAT
AAAAGTTACACAGGAACAATATGAATTATATTGTGAAATGGGCTCCACTTTTCAGCTCTG
TAAGATTTGTGCAGAGAATGACAAAGATGTCAAGATTGAGCCTTGTGGGCATTTGATGTG
CACCTCTTGCCTTACGGCATGGCAGGAGTCGGATGGTCAGGGCTGCCCTTTCTGTCGTTG
TGAAATAAAAGGAACTGAGCCCATAATCGTGGACCCCTTTGATCCAAGAGATGAAGGCTC
CAGGTGTTGCAGCATCATTGACCCCTTTGGCATGCCGATGCTAGACTTGGACGACGATGA
TGATCGTGAGGAGTCCTTGATGATGAATCGGTTGGCAAACGTCCGAAAGTGCACTGACAG
GCAGAACTCACCAGTCACATCACCAGGATCCTCTCCCCTTGCCCAGAGAAGAAAGCCACA
GCCTGACCCACTCCAGATCCCACATCTAAGCCTGCCACCCGTGCCTCCTCGCCTGGATCT
AATTCAGAAAGGCATAGTTAGATCTCCCTGTGGCAGCCCAACGGGTTCACCAAAGTCTTC
TCCTTGCATGGTGAGAAAACAAGATAAACCACTCCCAGCACCACCTCCTCCCTTAAGAGA
TCCTCCTCCACCGCCACCTGAAAGACCTCCACCAATCCCACCAGACAATAGACTGAGTAG
ACACATCCATCATGTGGAAAGCGTGCCTTCCAGAGACCCGCCAATGCCTCTTGAAGCATG
GTGCCCTCGGGATGTGTTTGGGACTAATCAGCTTGTGGGATGTCGACTCCTAGGGGAGGG
CTCTCCAAAACCTGGAATCACAGCGAGTTCAAATGTCAATGGAAGGCACAGTAGAGTGGG
CTCTGACCCAGTGCTTATGCGGAAACACAGACGCCATGATTTGCCTTTAGAAGGAGCTAA
GGTCTTTTCCAATGGTCACCTTGGAAGTGAAGAATATGATGTTCCTCCCCGGCTTTCTCC
TCCTCCTCCAGTTACCACCCTCCTCCCTAGCATAAAGTGTACTGGTCCGTTAGCAAATTC
TCTTTCAGAGAAAACAAGAGACCCAGTAGAGGAAGATGATGATGAATACAAGATTCCTTC
ATCCCACCCTGTTTCCCTGAATTCACAACCATCTCATTGTCATAATGTAAAACCTCCTGT
TCGGTCTTGTGATAATGGTCACTGTATGCTGAATGGAACACATGGTCCATCTTCAGAGAA
GAAATCAAACATCCCTGACTTAAGCATATATTTAAAGGGAGATGTTTTTGATTCAGCCTC
TGATCCCGTGCCATTACCACCTGCCAGGCCTCCAACTCGGGACAATCCAAAGCATGGTTC
TTCACTCAACAGGACGCCCTCTGATTATGATCTTCTCATCCCTCCATTAGGTGAAGATGC
TTTTGATGCCCTCCCTCCATCTCTCCCACCTCCCCCACCTCCTGCAAGGCATAGTCTCAT
TGAACATTCAAAACCTCCTGGCTCCAGTAGCCGGCCATCCTCAGGACAGGATCTTTTTCT
TCTTCCTTCAGATCCCTTTGTTGATCTAGCAAGTGGCCAAGTTCCTTTGCCTCCTGCTAG
AAGGTTACCAGGTGAAAATGTCAAAACTAACAGAACATCACAGGACTATGATCAGCTTCC
TTCATGTTCAGATGGTTCACAGGCACCAGCCAGACCCCCTAAACCACGACCGCGCAGGAC
TGCACCAGAAATTCACCACAGAAAACCCCATGGGCCTGAGGCGGCATTGGAAAATGTCGA
TGCAAAAATTGCAAAACTCATGGGAGAGGGTTATGCCTTTGAAGAGGTGAAGAGAGCCTT
AGAGATAGCCCAGAATAATGTCGAAGTTGCCCGGAGCATCCTCCGAGAATTTGCCTTCCC
TCCTCCAGTATCCCCACGTCTAAATCTATAGCAGCCAGAACTGTAGACACCAAAATGGAA
AGCAATCGATGTATTCCAAGAGTGTGGAAATAAAGAGAACTGAGATGGAATTCAAGAGAG
AAGTGTCTCCTCCTCGTGTAGCAGCTTGAGAAGAGGCTTGGGAGTGCAGCTTCTCAAAGG
AGACCGATGCTTGCTCAGGATGTCGACAGCTGTGGCTTCCTTGTTTTTGCTAGCCATATT
TTTAAATCAGGGTTGAACTGACAAAAATAATTTAAAGACGTTTACTTCCCTTGAACTTTG
AACCTGTGAAATGCTTTACCTTGTTTACAGTTTGGCAAAGTTGCAGTTTGTTCTTGTTTT
TAGTTTAGTTTTGTTTTGGTGTTTTGATACCTGTACTGTGTTCTTCACAGACCCTTTGTA
GCGTGGTCAGGTCTGCTGTAACATTTCCCACCAACTCTCTTGCTGTCCACATCAACAGCT
AAATCATTTATTCATATGGATCTCTACCATCCCCATGCCTTGCCCAGGTCCAGTTCCATT
TCTCTCATTCACAAGATGCTTTGAAGGTTCTGATTTTCAACTGATCAAACTAATGCAAAA
AAAAAAAAGTATGTATTCTTCACTACTGAGTTTCTTCTTTGGAAACCATCACTATTGAGA
GATGGGAAAAACCTGAATGTATAAAGCATTTATTTGTCAATAAACTGCCTTTTGTAAGGG
GTTTTCACATAACATAGAGGAGCTTCCCTTTTTTGTTTAAGTTTTGTAACCTTTAATCCT
CCATATTCTCATGTCTGTCATCCCAGGGGTGTCACAACTGTAAAAATCTACAATATTAGA
AAGCAGCTACTACAGATGTGGAAGAGAGAACACTTGTATAAGACAATGCTGTACTGAAGT
TATATAACAAGGTCCCCTGATACTTATGCCTGCATTACTTTGAGGGATGCTGAATGAGAG
GACCATCTCCCTGAAATATATTAATAATTTTCAGATAAAATTATGAACATAACATACCTT
TTCTCAAGTGGAATTAGAGTTCATTTCCCATTTAAGTGATTACACTCTATCTCCTAAGAG
CTGTGGGAACCAGTTCATATTGCAGTGGAAACATTAACTCTTCGTTGCACTGTTGAGTGT
CAAGGCTACTGTGGCAATGTTTTTTGCAAAGTTCTCAGTAATTTTCTCTCTGCAATCAAA
TTAGAGTTCATATTTAATTTGCAGATTCTCTCATTCATTGCTCCACACTGCTTTATCAAA
TCAGGTGAAAGAAATTAATGTAGTTTTGCCTATTTTACAAAATGGTGGTTGGTTCTTTAA
ACACCATGTTATTACTCTTAATAAATCTACAAATATTTATTGAGCATCTATGATATGCTT
GGTGCTGTTAGGCACTGTGTTTTTAAAGCACAAACTCTCAAAAGCTGATTCCAGCGTAAT
GTTTTATTTTTGTTTTTCTGTGTTTTTTATGACAAAGTCTGTCTGATAGACAAAGCCTGG
AAGGTTTCCCCCAGGGCTTTAGAATTTAGAATTAGCTGGTTTTCATTTCAAATGGGAAAT
TAATGGAGAAATGAGATAAAATCATCTCTGTGTAAATGCTTGAACCCACAGAAAGTTTTC
TAAATATGGACTAATTGTGGGTTTGTGCATATTTCTGTGTCTCCTCTTTTCACTTCACAC
CCACCATGATATAAAAAGATGCATCAGAGAGTGAGCCTGCCTTCAGGACCTGAAAGGACA
TGACTGAACATCTAGTAGATCTGGTGGAAATTAATGTTATACAAAAGACACGTAGACTAA
GTTGACCCTGGGAGAGGAGTTAATACATTCCTTTGCAAAGTGACATGTGCCCTTTTTTTG
ACAGTCTGGCTTTCATGGTATGAGATGAGGACTCACAGGCCTTGGGTAATTTCTGCTTTT
GTATGAATTTTTTCAGATGGTTCTGAGCTGGTTATGTCCCTGGAGGGGAATTTTTCATTT
GCCTTAGATGTTCTTCCCATGAGTAGGTACATGAGTGAAGTTTCTTACACTTTTAAAATT
GCATTGGCAAATTTTCTTTTGCTTTATGAACCCCTGTTTTGTCATTATGATTTTTCACTT
GTTTTAACAGTTTCAGATGTCACCTTGGAATAGCACTGTTTATTTTGGCCTTTTTATGAT
TGCTGATGATAGGTACAGTCTAAAGGCCAAAAGTTGCCACTTCATTGTGATAACATTGTT
GCAACATTCCTAATATATTAGAGAATGATGTAAAATAAGAATGTTAGAGAACATAGCACA
TTCTCATTCAGTTTATAAACAATATTTGAAAATTTCCAGTGAGAATTAAAAAAGGACTAG
TGATGATATAGCAAACCTGGACCTGAAATTTGGGGGTGGGGGGTGGGGGGATATCTGTTT
TGCAGAGAAAATTTACCAGCCTCCAGCAAAATCTCTGCATCTTGTACTCAATAGCAACCA
TTAGTATTGTCATTTAAAAAGAATGAATCAAAAATTCATACGTAATGGAATGAAAAGAGG
AAAACTTTCTATTAAACACTGTCAAGAAAGACCCATTGCTATCTATCACCTATGAAATTA
AACCTAAAAAAATTTTTTTTTATTGTAAAAGCGACTGCTCGTTGATGTCTGGAAGTGATC
CAGACTTTGTTTCACTGTGATCCAAAAAGTTAGACATTCCTTCCATTTCTCAAGATTTGG
TAACAATTTTTTTTTAAGTCAGCATTTCATATAATACATAAAATTAAGACAAATTAACTT
ACTGATATGTGGCCAATATCAACCCTTCTCACCCAACCCAAACATGTTCTGGAGATAGAA
GGACTTATCCTCAATTATATTCCAGTAAATTTATCTCCATAATCTGTTTTATCCCCTAAT
GTATGATATATCTCACCAAATTTTTCTAGAATTGAATAAAAGCAGTTTTTGCTTAACTTG
AATTTCCTTCCACAAATACAACCTTCAGCTCTTCCCTCTCTGTTTCCCTTTTGCCCACAT
TGCAAATAGTCTTCATAATAGAACCCTCACTGCAACTTAAAAGGGTCCCATTTCTTAACT
CAGCATTTCATATACCAAGAACACTTGCAAAGATTTCTTCATAATGTGATTTTTTAATTT
TTCAGTTCCAGAAGCATTTCCTACAGTTCGAACGTTATTTTTTCTCTCAGATTTTCAACT
TGAAGCTTTGATTTGCACTGAATTAACTTGGATAAAATTTTAGTTTCTCTCTTCAGCTAA
CAGATTTGGAAGCAAATTACAGTATACTTGAATAATTCAGGTACTACCTGTTGACCTGGA
ATTTTAGTGATTCTGGGAAAGTTTTCCAGACAAAGACACCAATAGAGTGAAGGGTTTTTT
CCCCAATTACTATTTTATTGTTTTTTAAAATGCCTTTTTAAAACTTGTGTGATGTGGCAA
AATAGTCATATGTTCAATTAATTTATATTTTATTCATTCCTTTTCAATTCTGGTTATTAT
GTAACCTCAAGTACTTTATCTGTTCTTTTAAAGTATTTTATAAAATGAACGTTAACTAAA

Protein Sequence

>868 : length: 982
MANSMNGRNPGGRGGNPRKGRILGIIDAIQDAVGPPKQAAADRRTVEKTWKLMDKVVRLC
QNPKLQLKNSPPYILDILPDTYQHLRLILSKYDDNQKLAQLSENEYFKIYIDSLMKKSKR
AIRLFKEGKERMYEEQSQDRRNLTKLSLIFSHMLAEIKAIFPNGQFQGDNFRITKADAAE
FWRKFFGDKTIVPWKVFRQCLHEVHQISSGLEAMALKSTIDLTCNDYISVFEFDIFTRLF
QPWGSILRNWNFLAVTHPGYMAFLTYDEVKARLQKYSTKPGSYIFRLSCTRLGQWAIGYV
TGDGNILQTIPHNKPLFQALIDGSREGFYLYPDGRSYNPDLTGLCEPTPHDHIKVTQEQY
ELYCEMGSTFQLCKICAENDKDVKIEPCGHLMCTSCLTAWQESDGQGCPFCRCEIKGTEP
IIVDPFDPRDEGSRCCSIIDPFGMPMLDLDDDDDREESLMMNRLANVRKCTDRQNSPVTS
PGSSPLAQRRKPQPDPLQIPHLSLPPVPPRLDLIQKGIVRSPCGSPTGSPKSSPCMVRKQ
DKPLPAPPPPLRDPPPPPPERPPPIPPDNRLSRHIHHVESVPSRDPPMPLEAWCPRDVFG
TNQLVGCRLLGEGSPKPGITASSNVNGRHSRVGSDPVLMRKHRRHDLPLEGAKVFSNGHL
GSEEYDVPPRLSPPPPVTTLLPSIKCTGPLANSLSEKTRDPVEEDDDEYKIPSSHPVSLN
SQPSHCHNVKPPVRSCDNGHCMLNGTHGPSSEKKSNIPDLSIYLKGDVFDSASDPVPLPP
ARPPTRDNPKHGSSLNRTPSDYDLLIPPLGEDAFDALPPSLPPPPPPARHSLIEHSKPPG
SSSRPSSGQDLFLLPSDPFVDLASGQVPLPPARRLPGENVKTNRTSQDYDQLPSCSDGSQ
APARPPKPRPRRTAPEIHHRKPHGPEAALENVDAKIAKLMGEGYAFEEVKRALEIAQNNV
EVARSILREFAFPPPVSPRLNL