ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

867

Name

CBL

Synonym

C-CBL|CBL2|FRA11B|NSLL|RNF55;Cbl proto-oncogene, E3 ubiquitin protein ligase;CBL;Cbl proto-oncogene, E3 ubiquitin protein ligase

Definition

Cas-Br-M (murine) ecotropic retroviral transforming sequence|E3 ubiquitin-protein ligase CBL|RING finger protein 55|casitas B-lineage lymphoma proto-oncogene|fragile site, folic acid type, rare, fra(11)(q23.3)|oncogene CBL2|proto-oncogene c-Cbl|signal tra

Position

11q23.3

Gene Type

protein-coding

Pathways and Diseases

Pathway

Endocytosis;KEGG PATHWAY;hsa04144

Pathway

Signaling in Immune system;Reactome;REACT:6900

Pathway

il-2 receptor beta chain in t cell activation;PID BioCarta;100129

Pathway

Fc-epsilon receptor I signaling in mast cells;PID Curated;200003

Pathway

VEGFR1 specific signals;PID Curated;200151

Pathway

PDGFR-beta signaling pathway;PID Curated;200127

Pathway

Signaling events mediated by Hepatocyte Growth Factor Receptor (c-Met);PID Curated;200032

Pathway

EGFR downregulation;PID Reactome;500515

Pathway

sprouty regulation of tyrosine kinase signals;PID BioCarta;100029

Pathway

Bacterial invasion of epithelial cells;KEGG PATHWAY;hsa05100

Pathway

IL4-mediated signaling events;PID Curated;200018

Pathway

Signaling by EGFR;Reactome;REACT:9417

Pathway

Chronic myeloid leukemia;KEGG PATHWAY;hsa05220

Pathway

EPO signaling pathway;PID Curated;200157

Pathway

T cell receptor signaling pathway;KEGG PATHWAY;hsa04660

Pathway

Ubiquitin mediated proteolysis;KEGG PATHWAY;hsa04120

Pathway

cbl mediated ligand-induced downregulation of egf receptors pathway;PID BioCarta;100216

Pathway

Reelin signaling pathway;PID Curated;200051

Pathway

Pathways in cancer;KEGG PATHWAY;hsa05200

Pathway

EGF receptor signaling pathway;PANTHER;P00018

Pathway

IFN-gamma pathway;PID Curated;200110

Pathway

CDC42 signaling events;PID Curated;200057

Pathway

Insulin signaling pathway;KEGG PATHWAY;hsa04910

Pathway

Insulin Pathway;PID Curated;200012

Pathway

TCR signaling in naive CD4+ T cells;PID Curated;200022

Pathway

EPHA2 forward signaling;PID Curated;200185

Pathway

ErbB signaling pathway;KEGG PATHWAY;hsa04012

Pathway

Paxillin-dependent events mediated by a4b1;PID Curated;200117

Pathway

EPHA forward signaling;PID Curated;200121

Pathway

Paxillin-independent events mediated by a4b1 and a4b7;PID Curated;200178

Pathway

Jak-STAT signaling pathway;KEGG PATHWAY;hsa04630

Pathway

Integrins in angiogenesis;PID Curated;200109

Pathway

Internalization of ErbB1;PID Curated;200146

Pathway

TCR signaling in naive CD8+ T cells;PID Curated;200062

Pathway

Notch signaling pathway;PID Curated;200013

Pathway

Signaling events mediated by Stem cell factor receptor (c-Kit);PID Curated;200156

Pathway

FGF signaling pathway;PID Curated;200189

Disease

Stroke;FunDO

Disease

Leukemia;FunDO

Disease

Esotropia;FunDO

External Links

Links to cell senescence gene database

867

Links to epithelial mesenchymal transition gene database

867

Links to ovarian cancer gene database

867

Links to endometrial cancer gene database

867

Links to iHOP

867

Sequence Information

Nucleotide Sequence

>867 : length: 11241
TCCGCCCGGATAGCCGGCGGCGGCGGCGGCGGCGGCGGCGGCGGCGGCCGGGAGAGGCCC
CTCCTTCACGCCCTGCTTCTCTCCCTCGCTCGCAGTCGAGCCGAGCCGGCGGACCCGCCT
GGGCTCCGACCCTGCCCAGGCCATGGCCGGCAACGTGAAGAAGAGCTCTGGGGCCGGGGG
CGGCAGCGGCTCCGGGGGCTCGGGTTCGGGTGGCCTGATTGGGCTCATGAAGGACGCCTT
CCAGCCGCACCACCACCACCACCACCACCTCAGCCCCCACCCGCCGGGGACGGTGGACAA
GAAGATGGTGGAGAAGTGCTGGAAGCTCATGGACAAGGTGGTGCGGTTGTGTCAGAACCC
AAAGCTGGCGCTAAAGAATAGCCCACCTTATATCTTAGACCTGCTACCAGATACCTACCA
GCATCTCCGTACTATCTTGTCAAGATATGAGGGGAAGATGGAGACACTTGGAGAAAATGA
GTATTTTAGGGTGTTTATGGAGAATTTGATGAAGAAAACTAAGCAAACCATAAGCCTCTT
CAAGGAGGGAAAAGAAAGAATGTATGAGGAGAATTCTCAGCCTAGGCGAAACCTAACCAA
ACTGTCCCTCATCTTCAGCCACATGCTGGCAGAACTAAAAGGAATCTTTCCAAGTGGACT
CTTTCAGGGAGACACATTTCGGATTACTAAAGCAGATGCTGCGGAATTTTGGAGAAAAGC
TTTTGGGGAAAAGACAATAGTCCCTTGGAAGAGCTTTCGACAGGCTCTACATGAAGTGCA
TCCCATCAGTTCTGGGCTGGAGGCCATGGCTCTGAAATCCACTATTGATCTGACCTGCAA
TGATTATATTTCGGTTTTTGAATTTGACATCTTTACCCGACTCTTTCAGCCCTGGTCCTC
TTTGCTCAGGAATTGGAACAGCCTTGCTGTAACTCATCCTGGCTACATGGCTTTTTTGAC
GTATGACGAAGTGAAAGCTCGGCTCCAGAAATTCATTCACAAACCTGGCAGTTATATCTT
CCGGCTGAGCTGTACTCGTCTGGGTCAGTGGGCTATTGGGTATGTTACTGCTGATGGGAA
CATTCTCCAGACAATCCCTCACAATAAACCTCTCTTCCAAGCACTGATTGATGGCTTCAG
GGAAGGCTTCTATTTGTTTCCTGATGGACGAAATCAGAATCCTGATCTGACTGGCTTATG
TGAACCAACTCCCCAAGACCATATCAAAGTGACCCAGGAACAATATGAATTATACTGTGA
GATGGGCTCCACATTCCAACTATGTAAAATATGTGCTGAAAATGATAAGGATGTAAAGAT
TGAGCCCTGTGGACACCTCATGTGCACATCCTGTCTTACATCCTGGCAGGAATCAGAAGG
TCAGGGCTGTCCTTTCTGCCGATGTGAAATTAAAGGTACTGAACCCATCGTGGTAGATCC
GTTTGATCCTAGAGGGAGTGGCAGCCTGTTGAGGCAAGGAGCAGAGGGAGCTCCCTCCCC
AAATTATGATGATGATGATGATGAACGAGCTGATGATACTCTCTTCATGATGAAGGAATT
GGCTGGTGCCAAGGTGGAACGGCCGCCTTCTCCATTCTCCATGGCCCCACAAGCTTCCCT
TCCCCCGGTGCCACCACGACTTGACCTTCTGCCGCAGCGAGTATGTGTTCCCTCAAGTGC
TTCTGCTCTTGGAACTGCTTCTAAGGCTGCTTCTGGCTCCCTTCATAAAGACAAACCATT
GCCAGTACCTCCCACACTTCGAGATCTTCCACCACCACCGCCTCCAGACCGGCCATATTC
TGTTGGAGCAGAATCCCGACCTCAAAGACGCCCCTTGCCTTGTACACCAGGCGACTGTCC
CTCCAGAGACAAACTGCCCCCTGTCCCCTCTAGCCGCCTTGGAGACTCATGGCTGCCCCG
GCCAATCCCCAAAGTACCAGTATCTGCCCCAAGTTCCAGTGATCCCTGGACAGGAAGAGA
ATTAACCAACCGGCACTCACTTCCATTTTCATTGCCCTCACAAATGGAGCCCAGACCAGA
TGTGCCTAGGCTCGGAAGCACGTTCAGTCTGGATACCTCCATGAGTATGAATAGCAGCCC
ATTAGTAGGTCCAGAGTGTGACCACCCCAAAATCAAACCTTCCTCATCTGCCAATGCCAT
TTATTCTCTGGCTGCCAGACCTCTTCCTGTGCCAAAACTGCCACCTGGGGAGCAATGTGA
GGGTGAAGAGGACACAGAGTACATGACTCCCTCTTCCAGGCCTCTACGGCCTTTGGATAC
ATCCCAGAGTTCACGAGCATGTGATTGCGACCAGCAGATTGATAGCTGTACGTATGAAGC
AATGTATAATATTCAGTCCCAGGCGCCATCTATCACCGAGAGCAGCACCTTTGGTGAAGG
GAATTTGGCCGCAGCCCATGCCAACACTGGTCCCGAGGAGTCAGAAAATGAGGATGATGG
GTATGATGTCCCAAAGCCACCTGTGCCGGCCGTGCTGGCCCGCCGAACTCTCTCAGATAT
CTCTAATGCCAGCTCCTCCTTTGGCTGGTTGTCTCTGGATGGTGATCCTACAACAAATGT
CACTGAAGGTTCCCAAGTTCCCGAGAGGCCTCCAAAACCATTCCCGCGGAGAATCAACTC
TGAACGGAAAGCTGGCAGCTGTCAGCAAGGTAGTGGTCCTGCCGCCTCTGCTGCCACCGC
CTCACCTCAGCTCTCCAGTGAGATCGAGAACCTCATGAGTCAGGGGTACTCCTACCAGGA
CATCCAGAAAGCTTTGGTCATTGCCCAGAACAACATCGAGATGGCCAAAAACATCCTCCG
GGAATTTGTTTCCATTTCTTCTCCTGCCCATGTAGCTACCTAGCACACCATCTCCCTGCT
GCAGGTTTAGAGGACCAGTGAGTTGGGAGTTATTACTCAAGTGGCACCTAGAAGGGCAGG
AGTTCCTTTGGTGACTTCACAGTGAAGTCTTGCCCTCTCTGTGGGATATCACATCAGTGG
TTCCAAGATTTCAAAGTGGTGAAATGAAAATGGAGCAGCTAGTATGTTTTATTATTTTAT
GGGTCTTGAGTGCATTTGAAGGTGTCCTTCAGTTCCCACGTAGAGAGAGTGTGGATTATA
TTACATGATAACCTACCTGGGGAACAGTCCAGAAAGCTATAGAACAAGTATTTTGCTGGA
AATCCTAATTGAGGACTTAAGACTTCCTGGGTTAAGGATGTGGCCGTGTGTGTGTGTGTC
TGCCTGTGGTTGTATGTGTCCTTGTGATTATAAGATTAACCTGCTGTGTGTGTTAATTCC
AGGCAGGGAATTAGCACAAAAGGTTTAGGAAGGAATCTTTTTTTAAAGACTTCCATCTAC
TGTGGTATTATACCCAAGCCTAGTGTGTATTACAACTTCAACACTCCCCTTTGGCTTATA
TTACCATGTGCATAGCTAAAGTCTTCTATTTTTAGAACACCTTCTGTCTGTTCTTTCCCC
ATCAACTCCTTCCTCATCCTTCTTGGTGTTCTGTCATGGGCCATGGGCTTGCTATGGCCA
GCCTTACTGAGGCCAAGCAGCTTATGGGATGTTCTTTATTGTGTGTGATGGTATTGGTTT
GTTTGGTAGATAAGTGGGAGGAAAAGTACTGTTGCTACACTATTATAGGCATGTTTGATA
CTAGCAGCTAACACTGGTCACTCCAAAGCACTGTTTCTATAGGAACATTGAAGCTATTAA
GATGTTTTGATTATCCTAATTACATAATGACCGATTTGAGATAGAGGCCTTTAAATACAT
TCCATGCCCTCCCCAGAAAATAGTCTGTGGGAGTCAGTTGCCTTGGTGCCAGGTATGTGT
TCTGATGTAGGTCATGAGTCTTTCTACTTAATGGGAAGGGAAGAACATTTGTTTCCAGGA
TGACTTTCTGGCCAGAATACCGGAAAGCTTTTAGGAAGCTTCGTTCACATGCTATTTAAA
TGCACAAAATAGACAGTAAGGATTTATCTGTTCAGTTTTTCTTCCCAGTGAATTAATTTC
AGCTTATATGGGTGTCTTCATTTGAACATGAGGAATATTAGGTTATATTTTCAGCAGTGG
TTTTTTCCTTTGCCCTTTAAGGAGTGGGGATAATGTCCACGGTGGCCCAGCCTCTTGCTG
ATGGCACCTTCCCTGCATTGCTGCCTCCCGATGATGTGGTTCTTTTCTTGTGCCTGTGGC
TTTGGGAATGTAACATCTCTTTCCTCCTTTCCTTCCCTTTTCCTCTTCACCTGAGGTCCT
AAATACTCTCTGTAATTACTGTGTTCTTCACGGTAATTAGACATCATTCAGTGAATAAAT
TACTGTAGTCAAAGACAGTATGGGCTGGCAGTTTGTGTAATTGCAAGTTCATAAAGAGAA
TTGAGGGTCCAGTTGGGAGAACTATTAGTCAGTTCTTTTATATGCTGATAAATGATCCCT
CGAGTTCAGTTAGTATTCTGTCCAGAGTGTTTAGCTCACTTTCTTAGCAGTGTGTAAGCT
TTCTCCATGTCAGAAGCAAGCCTGCTCTTTGATAAATCTGTCTTCCTGAAAATCTAAATC
ATGCTTTTGTCTTTAGATCTACACAGAAATGACCCTCCTTGGATCAGTTTTCTTTCCAGT
CTAATCATCTTTGGAACTAAAACTTGTTCTAACTCGTCTCTTGGCATTCAGCTACTCCTA
GATCTTTTGGTTTTATCCCCTGGCCTCAGAGCCATTTATATTCCCAGAGTAGGCAGTACA
GGATCTCGTGTTGATTTGCTGTGGTTACCCAGTGTCTTCTCTACATGGCATAAAGCGGCA
AAGCCCACCATTAGGTGAGGCGGTCCCGAGTTGAGGTAGAGTGGGGCAGAGGAAGATGGC
AGTGAATATCAAACAGTAGACCGCCATCAACTTCTAACAGCCAGTACACACACTGTTTCA
TTTTGAGGTAACGTTCAGTTTTGCATTTTGTTTAAATATTGAAGGCCTAGACAAAGAACT
AGAAAAAAAAAAGCAGTTTCCAGGCCCATCCATATTGTAATTTTTCTTTATCTGCAGATA
TTGCCTGTAGTCTAAAGATCTCTTTGGAAGACAAAGCATTGGCTATATATCTTTTGCCTT
TTCCATGCATCTAAATCTTCTCTGGAGATTATCTCCCTACTGTGTAGGTTAAGGGCAGTC
TCGACTTTTCCTTTTTTGAGTCCTGTGTGGCTCTTTGAATCAGCGTGAAACTGAGGCTCC
AGCTCCCTGTGTTGTGTGTGTGTGCCATCCATGGGCTTGGGTGTCAGTTTGTCACAGGTA
TCTGCCAGCATTCAAGGTTTTGGATCATTTCATGAGGATCTTTCCTTTGACTGGGTGCTG
TGAGGACACACCTGGGTCTGTGCCTGAGATTGCCAGGCAAGATTAAGGAAAGTTTTCATG
TGGCTTTTGTTTTGAGGTTATTCTCAAAACCTTAATTTCTTATATTTTCTGTTGACTAAG
GCACCAGTAACCCATTCTTCACCCTCCATTTGTATGGCAATTTAAAAGTCTTTGGCTTTG
CTCTGAATTTAATTAAAACTGCCTTTTATGAACAGACTTCGAGTTTTGCCATTTTGGGCA
AGCCCTTCCGCTTGTCCCTTCCTAGTGGCTAATAAAGTAAAAAAACCCACACTACTTTGT
TCTCTTTTTCTCATATTCATTGGGCTGTTGTATTCAGCCAGTCTCATGCTTTCCCTGGGT
CTTCACGGATTGCTTTCCAAGCTGCCTTGTTGCGGGGTTGCTGCAGAGCAGCAACTGGAC
CTTTCCAGCTGTCGCCATGTTCCTTCCACTAAAGTAGAGGGTTCTTAAAATGGAAAAACC
TGTGGGCTCTTCATATACCTCCCTTTAGTTAAGTAATAGACCAGGCAGCTTCTCATCTCA
GCATTTACCTGTTAATATTTTTGTGAATAGTGCTCTCTACCTGTGGGTGGCCGTTCTCTT
CCACTTGCTCGTCTCCCCCCAGCCCCATTCTGCATAATCTACCATTCTTCTCCTCTCTTT
CTCTTCTTATACAGACCCTCATTACTGGGGCCCAAGATGTGGGATACTACTGTTAGTATT
ATTTAACTATTTTGTAGATTTAAAAGATTTCTGGTTAAGGGAGGTGGGGGTCACTGTTCA
TCACTCTTAAAATATGTGTTTTCTCTATAGAAAAGTAAAATGTGTTTATGGTCCCAAACA
GTCAACTCACAAATTTTTATAACAAAATTTCCTTGTAAAAACTAGGGACCATCTATATAT
TCCCTTTAAGATCTAGTTCTTTTTGTAGGTGTTCAGCAATGGTGATAAAGCAGAATATTC
TCCTACCTCACGTCATTAAAGTCAGAAGATTATAGACCTTCTCAAACTATAAGTCCCTCT
TCTTGCCGTTGGCCTTTCTGACTCTGGAATGACCACTGTTCATTGAAAAATAGTTTTCTG
ACTATTGGTCTGGCTCTAACAGTTTGTTTGTTCATCCAGCAAATGTTTATGAGTGATGAC
CATGTGCCAGAAATGTCAGGTATGTGTCCTTCCCTTGGCGCCACATAGTAGTTTACTAAT
GTTTGGGGGATTGTACTTGGACTGTCATAGCCTCTGCGTTTGACCTTAAAATAGCTCTTC
CCAGTAAGATTGTGCAATTTTTATTCACAGCTCTTCCATGTAGACTTACCTTTCCTCATA
GAGCTATCCTGGTTAATAACAGGCCAAGATTCTCCCATTATCCCCTGTTGTCTCCTGTAG
CTTTGATAATGCCTGGGAGATTCCTTGGTGTAAGTGTCATGGATACCGACTGTTTTTATG
TTGGAATTTGTTCCAACATAATTAGAATCTGTTTGGTGAGTTGAAAGGTAAGTTGGCTCA
GAGTTGCACAGTAGGGCATTAAATGTTTAAGCAAAGCATCTGCCCACACTCCCCTTTCCA
ATCTAGTGCCTTCCTTGAACTTTTTCCTGAGCTGCTACGTCCCTAATCCCCCTTGTTGGG
AGGATTTTCGTATCACCCTTATGGGACCTGTCACCATGTCCTGTACTATTTGGAATTGGT
TTTCCAGTCTTTCAACAACCGTTGTGGCTAACTATGTTTTAGAAGGGCTGGAGGTGTGGG
CCCTGTCTTCGGGTCTCAGGACCCAAAGATCCTTTAGTCAGTTGTTGGGTCTTCCAAGAG
CCAGACATTAATACAGATTGAACTCCATCAGTCCCCTAATTGTCAGCCTTTACCTCCCTC
CCAGAGCAAGGAGTTTAGGGATTCTAAAGCTTAGTGTCCACACATCATTCTACCAGACCT
TAGAGCTTTAGAAGCTCAATCTAAAATACTGTAACTCAGCATAAACTATTACTATCACTC
CTTTGAACTCAGTCTCCATGAGCAGTGTTTTGTTGGAAATACATAGAACGGCTTAATGCC
TAGAGGGTGGTGGATAGTGAAGGACGGTCAAGGTTATATTTTTGACTGCTTAGGGATTCT
TTGGATCCAAGAAACAGAAATGTTCAAGCGGAATAAAGGAGGGAGTGGAGTTGTGGTAAG
GATGCAGGGTATTTCGCAGAACCCAGGACGGGAAGTGCCTTTGGTTCTTGGGTGGAGCTG
GAACTGCAGAGCTTTGCACCTAGTCCTTTCTCCCGCTTCACAGTCTGCTTATGGTATATG
TGGCCCCCAAATAGGCACTCTAGTCCTCAAGTCTACACCACCTTCCAACTCTGGGGATCA
CCATGAACAAATTCTCAATTTCCCATACTTAATTTTTTTTTTTTTTGAGATGGAGTCTCG
CTGTGTCGCCCAGGCTGGAGTGCAGTGGTGCAGTCTCAACTCACCACAACCTCTGCCTCC
CAGGTTCAAGCAGTTCTCTGCCTCAACCTCCCGAGTAGCTGGGATTACAGGCGCCTGCCA
CCATGCCCAGCTAATGTTCATATTTTTAGTAGAGACAGGGTTTCACCGTCTTGGCTAGGC
TGGTCTTGAACTCCTGACCCTCATGATCCACCCACCTCGGCCTCCCAAAGTGCTAAGATT
ACAGGCGTGAGCCACCGCGCCCGGCCCATACTTCGTATTCTTAAAAAAAACTACACTCAG
CCCAGCACATTGATCAAGTATCTATCTCTGAGCAGTTGGCCTTGCCAGGGAGAGCAGAGA
TGTGGCAGGCTCCTTCAGCTGGAGACAGGGAGCTTCTCAGAGAAGTGAGCAGAGACTCCA
CAGACACCCTAAAAAGGCTTCTACTCAAGAAGTAAAGCCACTACTCCTGCCTTTTTGCTT
AGTGGACAGGAAGGCACAGGAGTTTGTCTGGGACATCATAGAAATTCTTAGGTTTAACTT
AATTCTGGTCATTGTCTTCTTTATTTCCTGTTTTTCTTCCCTTTGTCAGTCTTCGCATCC
AAGATTTCTTCCCTCCCTCTTGTGGGCCAGCCTGTCCTGTTCCAGAGCTAGCCTGTTCCT
GGGTAGCCTTCCTTAGCCTCCATTCAGCCTCAGGTCTTTTGCCTTCTTCCGTGTTTATTT
AGAGAGCAGAATCTAATAACGGGTTCCACTGTAGCCACTATCCATGGACTTCTGGGTCCT
CTTCAGGTTTGAGTGCTTGAAAATGTTCATTCTCTGGGCTTGTGGCCTGTCTCCTCCACT
CTCCTCCTCACCCTCTCGCTCCTTCCTGTGTGAGGGCCGCTCTGCAGTAATGTTCTCAGG
CAAGCCTTCCTAGGCACCTCAGAAACTACTTTGCCAGAGCCAGTAAGAATATATAATATT
GGAGCAGTTGCCAGGATAGAAATTAAATATAGATTCCAGTTTAGGATAGAGTTTTTACCG
AGAGCTCTTTAGACAGTATACCTGTGTCTTCTCTGGCAATTGCTTTCATTTTAGTCCTAT
ATAAAAGCTTTCCTTTTCTGTTTTTTTTTAAAACTATGCTTTTGCTTGCCTAAATCTTTT
GATCTTATATTTCTCTCATCTCAGAGCCTGTCCTGAGTTGTAAGGTATTTCATACTGCCT
TACTTAAAAGTTTTTTAAACTACTAGAGTCATTTGATACACACAGAAGTTACCTAATAAT
CCAAAGATGTCCATCAAGGGAGGAAGGGTGGGTCATCAGACTTTGCCTTTGATGTTGTAG
ACTAGGCTCCTGAGTTAAGCAGCAGAGGGACAGCAGTGCCATGTGCCTTCACTGTGTCCC
AGGAAATCTGGGTTGGTTCCAGTGGGAAATACCAGTATTTCTTGGTTCTGGAAAGTAGCA
AAAGAGTAGGAGATGGGGAAATAGGGATGGGGAGAGCAAGCCCCGCATGTCCATGGCGAG
TCAGGTGGGGAGCACGGGTGGAAGGGCCGGCTGTTGACAGACAGACTAAGCTGTGTGGTG
CTCTTGCCGCCCCTTCCTGGGTACAGAGCTTGAGAAAAATGCAGCCGACCACTCCCTGTG
TTTGTACAGAGCAAAGCCCAAAAGCCAACCTCAGATCTCCTGATTTGGCAGCTGAAGAAA
TCAGCAGAGTCCTGATTGCCTGATTCAGTCCCAAAAATGAATGTCAGGCCCCGCCCCCTC
CCCACCAACATTGCCTCTCCTACATTCTCCTTCTGCCCCTAAATCAGACAGGAGGCCAGA
GAGGAGTATTGCTCAATGCGTGCTATGTGCAACTCCTCAGGCCTTGTGCCACCTCCATGC
TGAGCCCTGAAGCAGGGTGTCCTGGGTGCCTGTGTGTCAGCTCCCTCCTCTCTACCTACC
TCTGACCTTCTTGTGGGTGAGGGTGGCCATGCTTATGGCCATCTTAAAACTGGAGAGGCA
GAGAACTACTTATGAGTCTGTAGACCACGTGTTGTCTTCCATGGCCTGTTTCTCCTGCTG
TCTGGGTGAGTGAGCCTGCAACGCAATGCCCATGAGAGTAAATGCCTCCTGACCTACCCT
GCTCAGCACTGTTCTAGTGTCTTGGCCTTGAAAGAAAAGCCTGACTTCCTGCTGACACAT
GTGGTAGGGGCATGGCAGCTATGAGGCACCTCCTACGTCTGTTTTCTGGCTGTGGTGACT
TGGGATTTTTAACCTTATATATCTTTTTCCTTTACTCAAAACAAAACAATTTTTAGCACA
CTGAAAAAAAAAAAAAGCCAAATGTTTTGTGCCTTTCTAAGGCAGCACTGTATCCCAGGC
TGCATTTTAGGACTTAATATGGAAATACCAGAGTCTGAGCTCCTCTACCTTGAGTTTCAT
TAGTCCTTAGTGTCTAGGAGACAGGAAAGAATGCTCTCTGTGACTGGAGAGGTGACATGC
AGGTGCAGTGTGTCTGGAGTCCCTTTCCCCTGCTGTGAGACTTCAGTGGAGGAGAGAAGC
ATTGTACCCTGGGATCATTTGGTTGGTTCCAATCACAAGCTTAGTTATCAGGTTGCATGC
CTTGTCTCCTGCAAAAGACAGAATGTTTCACAATTCCCAGGTAAACTCTGGACCATTCCA
AGTGTCCTAGCCTTCTGATGACATTAATTACCTAGTTGTGTCGAGGAGTATAGGATGGAC
TCTCCTGAGAAGGGGAGGTTGGTGGCTTTGTCTTTTCTTTTTGCTGGATCCTGAACTGGT
CTAGACCTCCTGCCCCCACCCCCCAGCCCCCATCAGATGTGGCTGGCCTTTCATTTGAAG
GCTTCAGACTTAAAGCATTAAGCAGCTAGTGCCCTCTGCAGGGCCTGGTTTCCCCAGGGA
AGGGCAGCAAGGAACATGGGACCAGAAGCCTGTCCTCAGTAATGTGACTATAGTGAGCTT
TAGCAAAAGTTTTTCTATATAATGACATCTTACTTATCTTTTACCCTTTCCTCAGTTTTC
CCCTGCCTTTAACTAATAAAGAATTGGGAGACAGAAATTTTAAAGTCCTCCTTATTCAAG
ATTTTGAAATTCTTAGCCTGGGAGTGCTGGAGAGAACCTGATGCTTTCTCCAGAATGAAG
AGTCCCAATTTGTATATCAGTGTTAAGAAGAAAACAAAACAAACACATAGGTGAGATTTT
CGTGGACTATTTTAAAAATGTGTCATTAATATAAAAAATTTATATTAGCAGTATTTAATC
ATTCTCACCTGTAAAGAATAAGAAAAACAGAAGGTAAATATTCTTACAGAGAATAGCAGA
GCTTTAAGATTCATTTTCATTTTAAGTCCATTTTATTTTGCCAGTGTATTAATGTTTAGA
AGTCTGTTTTACTAATGTTATTTATTAATTTTTTTTCATTTCCATACACAGTTAGTTAAC
TAAAGAGCTTTTTCAAGCACCCATGTCTGTAAAAAAATATTTTTAAATAAAGTTTCTTTT
GTTGTAGCAGAAAAAAAAAAA

Protein Sequence

>867 : length: 906
MAGNVKKSSGAGGGSGSGGSGSGGLIGLMKDAFQPHHHHHHHLSPHPPGTVDKKMVEKCW
KLMDKVVRLCQNPKLALKNSPPYILDLLPDTYQHLRTILSRYEGKMETLGENEYFRVFME
NLMKKTKQTISLFKEGKERMYEENSQPRRNLTKLSLIFSHMLAELKGIFPSGLFQGDTFR
ITKADAAEFWRKAFGEKTIVPWKSFRQALHEVHPISSGLEAMALKSTIDLTCNDYISVFE
FDIFTRLFQPWSSLLRNWNSLAVTHPGYMAFLTYDEVKARLQKFIHKPGSYIFRLSCTRL
GQWAIGYVTADGNILQTIPHNKPLFQALIDGFREGFYLFPDGRNQNPDLTGLCEPTPQDH
IKVTQEQYELYCEMGSTFQLCKICAENDKDVKIEPCGHLMCTSCLTSWQESEGQGCPFCR
CEIKGTEPIVVDPFDPRGSGSLLRQGAEGAPSPNYDDDDDERADDTLFMMKELAGAKVER
PPSPFSMAPQASLPPVPPRLDLLPQRVCVPSSASALGTASKAASGSLHKDKPLPVPPTLR
DLPPPPPPDRPYSVGAESRPQRRPLPCTPGDCPSRDKLPPVPSSRLGDSWLPRPIPKVPV
SAPSSSDPWTGRELTNRHSLPFSLPSQMEPRPDVPRLGSTFSLDTSMSMNSSPLVGPECD
HPKIKPSSSANAIYSLAARPLPVPKLPPGEQCEGEEDTEYMTPSSRPLRPLDTSQSSRAC
DCDQQIDSCTYEAMYNIQSQAPSITESSTFGEGNLAAAHANTGPEESENEDDGYDVPKPP
VPAVLARRTLSDISNASSSFGWLSLDGDPTTNVTEGSQVPERPPKPFPRRINSERKAGSC
QQGSGPAASAATASPQLSSEIENLMSQGYSYQDIQKALVIAQNNIEMAKNILREFVSISS
PAHVAT