ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

8668

Name

EIF3I

Synonym

EIF3S2|PRO2242|TRIP-1|TRIP1|eIF3-beta|eIF3-p36;eukaryotic translation initiation factor 3, subunit I;EIF3I;eukaryotic translation initiation factor 3, subunit I

Definition

TGF-beta receptor-interacting protein 1|TGFbeta receptor-interacting protein 1|eIF-3-beta|eIF3 p36|eukaryotic translation initiation factor 3 subunit 2|eukaryotic translation initiation factor 3 subunit I|eukaryotic translation initiation factor 3, subuni

Position

1p34.1

Gene Type

protein-coding

Pathways and Diseases

Pathway

3' -UTR-mediated translational regulation;Reactome;REACT:1762

Pathway

Gene Expression;Reactome;REACT:71

Pathway

Metabolism of proteins;Reactome;REACT:17015

External Links

Links to cell senescence gene database

8668

Links to epithelial mesenchymal transition gene database

8668

Links to ovarian cancer gene database

8668

Links to endometrial cancer gene database

8668

Links to iHOP

8668

Sequence Information

Nucleotide Sequence

>8668 : length: 1636
CTCAGTATTCAAGAAGAGGGTCTTCATCTCCTGTAGCAACTGCTGGGCCCAGGTCGGCTC
ATGAACCCGCTGCAGGCCGGCGGAGGCCCGCTTCAGCAGCGGCTGCGTGCCACCCCACAG
AGCGGCCACCAGCACCAGAGCCAACACCTGCCCTGAATGCAGACGAGGGCGGAGACCCAT
AATCCGGAAGTGACCTCGAAACCTTTTCCGGTCTTACTCACGTTGCGGCCTTCCTCGCGT
CACAGCCGGGATGAAGCCGATCCTACTGCAGGGCCATGAGCGGTCCATTACGCAGATTAA
GTATAACCGCGAAGGAGACCTCCTCTTTACTGTGGCCAAGGACCCTATCGTCAATGTATG
GTACTCTGTGAATGGTGAGAGGCTGGGCACCTACATGGGCCATACCGGAGCTGTGTGGTG
TGTGGACGCTGACTGGGACACCAAGCATGTCCTCACTGGCTCAGCTGACAACAGCTGTCG
TCTCTGGGACTGTGAAACAGGAAAGCAGCTGGCCCTTCTCAAGACCAATTCGGCTGTCCG
GACCTGCGGTTTTGACTTTGGGGGCAACATCATCATGTTCTCCACGGACAAGCAGATGGG
CTACCAGTGCTTTGTGAGCTTTTTTGACCTGCGGGATCCGAGCCAGATTGACAACAATGA
GCCCTACATGAAGATCCCTTGCAATGACTCTAAAATCACCAGTGCTGTTTGGGGACCCCT
GGGGGAGTGCATCATCGCTGGCCATGAGAGTGGAGAGCTCAACCAGTATAGTGCCAAGTC
TGGAGAGGTGTTGGTGAATGTTAAGGAGCACTCCCGGCAGATCAACGACATCCAGTTATC
CAGGGACATGACCATGTTTGTGACCGCGTCCAAGGACAACACAGCCAAGCTTTTTGACTC
CACAACTCTTGAACATCAGAAGACTTTCCGGACAGAACGTCCTGTCAACTCAGCTGCCCT
CTCCCCCAACTATGACCATGTGGTCCTGGGCGGTGGTCAGGAAGCCATGGATGTAACCAC
AACCTCCACCAGGATTGGCAAGTTTGAGGCCAGGTTCTTCCATTTGGCCTTTGAAGAAGA
GTTTGGAAGAGTCAAGGGTCACTTTGGACCTATCAACAGTGTTGCCTTCCATCCTGATGG
CAAGAGCTACAGCAGCGGCGGCGAAGATGGTTACGTCCGTATCCATTACTTCGACCCACA
GTACTTCGAATTTGAGTTTGAGGCTTAAGAAGCTGGATCTCCTGCCGGGCGTGGTGGCTC
ATGCCTGTAATCCCACCACTTTTTTTTTAAGGCAGGCGGATCACCTGAGGTCAGGAGTTT
AAGACCAGCCTGACCAACATGGAGAAACCTCGTCTCTACTAAAAATACAAAAATTAGCCA
GGCATGGTGGCACACGCCTATAGTCCCAGCTACTCAGGAGGCTGAGGCAGGAGAATCACT
TGAACCCAGGAGGCAGAGGTTGCAGTGAGCTGAGATCACGTCATTGCACTCCATCCTGAG
CCACAAGAGCAAAACTCCGTCTCAAAAAAAAAAAAGAAGAAGGTGGATCTCCAACCAGGC
CAGAGAAGATTCTCACAGAAGGTTTTGAACTCTAAGAAATAAATTGGTTTGGTAATAAAT
GGCTTCTGGTCAGATA

Protein Sequence

>8668 : length: 325
MKPILLQGHERSITQIKYNREGDLLFTVAKDPIVNVWYSVNGERLGTYMGHTGAVWCVDA
DWDTKHVLTGSADNSCRLWDCETGKQLALLKTNSAVRTCGFDFGGNIIMFSTDKQMGYQC
FVSFFDLRDPSQIDNNEPYMKIPCNDSKITSAVWGPLGECIIAGHESGELNQYSAKSGEV
LVNVKEHSRQINDIQLSRDMTMFVTASKDNTAKLFDSTTLEHQKTFRTERPVNSAALSPN
YDHVVLGGGQEAMDVTTTSTRIGKFEARFFHLAFEEEFGRVKGHFGPINSVAFHPDGKSY
SSGGEDGYVRIHYFDPQYFEFEFEA