ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

8660

Name

IRS2

Synonym

IRS-2;insulin receptor substrate 2;IRS2;insulin receptor substrate 2

Definition

-

Position

13q34

Gene Type

protein-coding

Pathways and Diseases

Pathway

Adipocytokine signaling pathway;KEGG PATHWAY;hsa04920

Pathway

Insulin signaling pathway;KEGG PATHWAY;hsa04910

Pathway

IL4-mediated signaling events;PID Curated;200018

Pathway

IL2-mediated signaling events;PID Curated;200082

Pathway

Neurotrophin signaling pathway;KEGG PATHWAY;hsa04722

Pathway

IGF1 pathway;PID Curated;200084

Pathway

EPO signaling pathway;PID Curated;200157

Pathway

Signaling by Insulin receptor;Reactome;REACT:498

Pathway

Signaling by FGFR;Reactome;REACT:9470

Pathway

Insulin/IGF pathway-protein kinase B signaling cascade;PANTHER;P00033

Pathway

Interleukin signaling pathway;PANTHER;P00036

Pathway

Type II diabetes mellitus;KEGG PATHWAY;hsa04930

Pathway

Signalling by NGF;Reactome;REACT:11061

Pathway

Insulin/IGF pathway-mitogen activated protein kinase kinase/MAP kinase cascade;PANTHER;P00032

Pathway

Aldosterone-regulated sodium reabsorption;KEGG PATHWAY;hsa04960

Pathway

Signaling events regulated by Ret tyrosine kinase;PID Curated;200058

Disease

longevity;GAD

Disease

Insulin Resistance;GAD

Disease

diabetes, type 2;GAD

Disease

polycystic ovarian syndrome;GAD

Disease

CANCER;GAD

Disease

METABOLIC;GAD

Disease

obesity;GAD

Disease

AGING;GAD

Disease

Diabetes mellitus, noninsulin-dependent;OMIM

Disease

colorectal cancer;GAD

External Links

Links to cell senescence gene database

8660

Links to epithelial mesenchymal transition gene database

8660

Links to ovarian cancer gene database

8660

Links to endometrial cancer gene database

8660

Links to iHOP

8660

Sequence Information

Nucleotide Sequence

>8660 : length: 7014
CGGGGACCGCGACGAGCCCGGGTCGCCGTTGGCAGCAGCAGCAGCAACACCAGCAGCAGC
AGCAGCCCCGGCGGCGGCGCGGACCCCGAGCGCCCGGGCGCACCCCGGCTTCCCGGAGCG
CGACGCGGCGGCAGCAGCCCCGGTGCGGCCGCGCGCGCCTTAGGCTCGGCCCCGCGGCTC
GGGGACCCCGACTCCCGGCCCAGCGAGCGCGTCCCCCGGCGCCGCCCGAGAGCCCGAGGA
GGCAGCGGCCGCAGGCAGCCGGGGAGGGGGGCGGCCACCGCCCGCGCCGGGCATCCTCAG
GAGCCCCAGAGCGCGGAGGGCGCGGCGCCGCCGAGCGGTGCTGGCCCCCGCGGGCCTCCC
CGGACCTTCCCCACCGCCTGGGCCCGAGGGACGCGTGATCGGGCGGGCGGCCGGGCGCAA
GGGTGGGAGGGAGCCGCCCCCGCCCGCGCCCCCTCCGCCCCTCGCCCCAACCCCTGGGCG
CCGGGCCCGGGCCGCGCGGCCTGAAGCGCCCGCGATGGCGAGCCCGCCGCGGCACGGGCC
GCCCGGGCCGGCGAGCGGAGACGGCCCCAACCTCAACAACAACAACAACAACAACAACCA
CAGCGTGCGCAAGTGCGGCTACCTGCGCAAGCAGAAGCATGGCCACAAGCGCTTCTTCGT
GCTGCGCGGACCCGGCGCGGGCGGCGACGAGGCGACGGCGGGCGGGGGGTCGGCGCCGCA
ACCGCCGCGGCTCGAGTACTACGAGAGCGAGAAAAAGTGGCGGAGCAAGGCAGGCGCGCC
GAAACGGGTGATCGCTCTCGACTGCTGCCTGAACATCAACAAGCGCGCCGACGCCAAGCA
CAAGTACCTGATCGCCCTCTACACCAAGGACGAGTACTTCGCCGTGGCCGCCGAGAACGA
GCAGGAGCAGGAGGGCTGGTACCGCGCGCTCACCGACCTGGTCAGCGAGGGCCGCGCGGC
CGCCGGAGACGCGCCCCCCGCCGCCGCGCCCGCCGCGTCCTGCAGCGCCTCCCTGCCCGG
CGCCCTGGGCGGCTCTGCCGGCGCCGCCGGGGCCGAGGACAGCTACGGGCTGGTGGCTCC
CGCCACGGCCGCCTACCGTGAGGTGTGGCAGGTGAACCTGAAGCCCAAGGGTCTGGGCCA
GAGCAAGAACCTGACGGGGGTGTACCGTCTGTGCCTGTCTGCGCGCACCATCGGCTTCGT
GAAGCTCAACTGCGAGCAGCCGTCGGTGACGCTGCAGCTCATGAACATCCGCCGCTGCGG
CCACTCGGACAGCTTCTTCTTCATCGAGGTGGGCCGCTCGGCCGTCACAGGCCCCGGCGA
GCTGTGGATGCAGGCGGACGACTCGGTGGTGGCGCAGAACATCCACGAGACCATCCTGGA
GGCCATGAAGGCGCTCAAGGAGCTCTTCGAGTTCCGGCCGCGCAGTAAGAGCCAATCGTC
GGGGTCGTCGGCCACGCACCCCATCAGCGTCCCCGGCGCGCGCCGCCACCACCACCTGGT
CAACCTGCCCCCCAGCCAGACGGGCCTGGTGCGCCGCTCGCGCACCGACAGCCTGGCCGC
CACCCCGCCGGCGGCCAAGTGCAGCTCGTGCCGGGTGCGCACCGCCAGCGAGGGCGACGG
CGGCGCGGCGGCGGGAGCGGCGGCCGCGGGCGCCAGGCCGGTGTCGGTGGCTGGGAGCCC
CCTGAGCCCCGGGCCGGTGCGCGCGCCCCTGAGCCGCTCGCACACCCTGAGCGGCGGCTG
CGGCGGCCGCGGGAGCAAGGTGGCGCTGCTGCCGGCAGGGGGCGCGCTGCAACACAGCCG
CTCCATGTCCATGCCCGTGGCGCACTCGCCGCCCGCCGCCACCAGCCCCGGCTCCCTGTC
GTCCAGCAGCGGCCACGGCTCGGGCTCCTACCCGCCGCCGCCCGGCCCGCACCCGCCTCT
GCCGCATCCGCTGCACCACGGCCCCGGCCAGCGGCCCTCCAGCGGCAGCGCCTCCGCCTC
GGGCTCCCCCAGCGACCCCGGCTTCATGTCCCTGGACGAGTACGGCTCCAGCCCAGGCGA
CCTGCGCGCCTTCTGCAGCCACCGAAGCAACACGCCCGAGTCCATCGCGGAGACGCCCCC
GGCCCGAGACGGCGGCGGCGGCGGTGAGTTCTACGGGTACATGACCATGGACAGGCCCCT
GAGCCACTGTGGCCGCTCCTACCGCCGGGTCTCGGGGGACGCGGCCCAGGACCTGGACCG
AGGGCTGCGCAAGAGGACCTACTCCCTGACCACGCCAGCCCGGCAGCGGCCGGTGCCCCA
GCCCTCCTCTGCCTCGCTGGATGAATACACCCTGATGCGGGCCACCTTCTCGGGCAGCGC
GGGCCGCCTCTGCCCGTCCTGCCCCGCGTCCTCTCCCAAGGTGGCCTACCACCCCTACCC
AGAGGACTACGGAGACATCGAGATCGGCTCCCACAGGAGCTCCAGCAGCAACCTGGGGGC
AGACGACGGCTACATGCCCATGACGCCCGGCGCGGCCCTCGCGGGCAGTGGGAGCGGCAG
CTGCAGGAGCGACGACTACATGCCCATGAGCCCCGCCAGCGTGTCCGCCCCCAAGCAGAT
CTTGCAGCCCAGGGCCGCCGCCGCCGCCGCCGCCGCCGTGCCTTCTGCGGGGCCTGCGGG
GCCAGCACCCACCTCTGCGGCGGGCAGGACATTCCCGGCGAGCGGGGGCGGCTACAAGGC
CAGCTCGCCCGCCGAGAGCTCCCCCGAGGACAGTGGGTACATGCGCATGTGGTGCGGTTC
CAAGCTGTCCATGGAGCATGCAGATGGCAAGCTGCTGCCCAACGGGGACTACCTCAACGT
GTCCCCCAGCGACGCGGTCACCACGGGCACCCCGCCCGACTTCTTCTCCGCAGCCCTGCA
CCCCGGCGGGGAGCCGCTCAGGGGCGTTCCCGGCTGCTGCTACAGCTCCTTGCCCCGCTC
CTACAAGGCCCCCTACACCTGTGGCGGGGACAGCGACCAGTACGTGCTCATGAGCTCCCC
CGTGGGGCGCATCCTGGAGGAGGAGCGTCTGGAGCCTCAGGCCACGCCAGGGCCCAGCCA
GGCGGCCAGCGCCTTCGGGGCCGGCCCCACGCAGCCCCCTCACCCTGTAGTGCCTTCGCC
CGTGCGGCCTAGCGGCGGCCGCCCGGAGGGCTTCTTGGGCCAGCGCGGCCGGGCGGTGAG
GCCCACGCGCCTGTCCCTGGAGGGGCTGCCCAGCCTGCCCAGCATGCACGAGTACCCACT
GCCACCGGAGCCCAAGAGCCCCGGCGAGTACATCAACATCGACTTTGGCGAGCCCGGGGC
CCGCCTGTCGCCGCCCGCGCCTCCCCTGCTGGCGTCGGCGGCCTCGTCCTCCTCGCTCTT
GTCCGCCAGCAGCCCGGCCTCGTCGCTGGGCTCAGGCACCCCGGGCACCAGCAGCGACAG
CCGGCAGCGGTCTCCGCTCTCCGACTACATGAACCTCGACTTCAGCTCCCCCAAGTCTCC
TAAGCCGGGCGCCCCGAGCGGCCACCCCGTGGGCTCCTTGGACGGCCTCCTGTCCCCCGA
GGCCTCCTCCCCGTATCCGCCGTTGCCCCCGCGTCCGTCCGCGTCCCCGTCGTCGTCTCT
GCAGCCGCCGCCACCGCCGCCGGCCCCGGGGGAGCTGTACCGCCTGCCCCCCGCCTCGGC
CGTTGCCACCGCCCAGGGCCCGGGCGCCGCCTCATCGTTGTCCTCGGACACCGGGGACAA
TGGTGACTACACCGAGATGGCTTTTGGTGTGGCCGCCACCCCGCCGCAACCTATCGCGGC
CCCCCCGAAGCCAGAAGCTGCCCGCGTGGCCAGCCCGACGTCGGGCGTGAAGAGGCTGAG
CCTCATGGAGCAGGTGTCGGGAGTCGAGGCCTTCCTGCAGGCCAGCCAGCCCCCGGACCC
CCACCGCGGCGCCAAGGTCATCCGCGCAGACCCGCAGGGGGGCCGCCGCCGCCACAGTTC
CGAGACCTTCTCCTCCACCACGACGGTCACCCCCGTGTCCCCGTCCTTCGCCCACAACCC
CAAGCGCCACAACTCGGCCTCCGTGGAAAATGTCTCTCTCAGGAAAAGCAGCGAGGGCGG
CGTGGGTGTCGGCCCTGGAGGGGGCGACGAGCCGCCCACCTCCCCACGACAGTTGCAGCC
GGCGCCCCCTTTGGCACCGCAGGGCCGGCCGTGGACCCCGGGTCAGCCCGGGGGCTTGGT
CGGTTGTCCTGGGAGCGGTGGATCGCCCATGCGCAGAGAGACCTCTGCCGGCTTCCAGAA
TGGTCTCAACTACATCGCCATCGACGTGAGGGAGGAGCCCGGGCTGCCACCCCAGCCGCA
GCCGCCGCCGCCGCCGCTTCCTCAGCCGGGAGACAAGAGCTCCTGGGGCCGGACCCGAAG
CCTCGGGGGTCTCATCAGCGCTGTGGGCGTCGGCAGCACCGGCGGCGGGTGCGGGGGGCC
GGGTCCCGGTGCCCTGCCCCCTGCCAACACCTACGCCAGCATTGACTTCTTGTCCCACCA
CTTGAAGGAGGCCACCATCGTGAAAGAGTGAAGATCTGTCTGGCTTTATCACCAGGATGT
CACATGTCAGAGAGTATCATTAAAAGAAGACGCTCAGCACTGTTTCAGCCCGAAGCTGCT
TGCAGTTTTCTTTTGGATCTGAGCAATGACTGTGTTTGGAAACATCTGTGGACTCTGTTA
GATGAGGCACCAACAAGGCAAGGTCACCTGCCTCTTTCCCTTGTTCCCGGATGGGGCATT
CATCATTGTGCTGTTTGCGTTTTGTTTTGTTTTGTTTTAACAAAATTAGCTGAAGAAGTT
ATTCTCAAGAAAATTGGATGTTTTCATTGGCCTTCTTAAATTGTGGCCAGTGTCTTTTAA
TTTCTTCTTCTTTTCCTTTTGGCAAAGCAGATATAACCCTCAGCATGCTAGGAGAGTGCA
CCCGTACCTATGGAAGTGGTAAAATCTGGTATTTACTGGCTTACACTCAAAACGACCACA
GTCCTACCTCAGTTCAAGGTAAAGCCGGATTTCCGTGGCGGGGGTCCCACAGGACCTCCT
GTAGTAGCCCCTGCGCTGTGTGTCTGGAGCGCGGTCCTCGGCCTTATTGAAATGGTCCAA
GTAGACAGCTGCTTGTTGGATTCCAGTGCAGGTACCTGCGATGTTTACGTCCACACCGAG
CCCAGTGTGGGACTGACATTTCTCAATGGAAGTGAAATTTGGGATTGGACTTTGAAGACG
GATTACTAAATAATAATTATTATATGTAACTGAAGCAACCTACTTTTGAAAATCAACTGT
ATTGGGTAGTGGGAGGTGGGAGGGAAGGGCTTTGGGAAGGGGATGAATATCTCTTTTTAC
CTTTAACAGACTTGTTTAATCTTCTCGATGTAGATGTTTATGTAGGTACTTCACATTGCA
AACGCCTTTTATTCTATTTACAAGCTCAGATGTCTCTGCTCTCCTGAATCTTGGGCATGC
CTTTCTGTAACCAAAAATCCCTGTAGGCGTGCTAGCAATTCCAGGGTGGTCCGGGTTTGG
CAGATTTGATTTTTAAAAAACGTATTATCTTTAATAAAATGTTATTATGTCAACCAGTGA
GGCTGCCCTGAACAAAAAAAACAAAAAGAAAAAAAAAAAAGGAAAGAAAGAAACTGATAA
AAAGAGGCATTCCAGCCCCTATGTTATTGATGGAAAAAGAAAAAGAAGAAAAGCAATCTC
GCAGTACATGTTACTTGTCGAAAAAATTCCGGACAAGACTACCCTTGTTTTATGTTTTCA
GTATTCTGAAAATACCAGTGTGTGGCAGTTCTCGCAGATGTTACCTAAAACTGCTGAACT
TGACCGGCAGAATGTTCTGCCGTTTTCTGCTCCCTCGACACTTGATTGGAGGGCTGTCGA
CCTCTCCTCCCGTGGGGGCTTCCCCAGTGCCTATCTTCTCTGATAGTCATGGAGAGGTTA
CACTAATTCATTGGAGATGTAAGTTGTTGGTTTTGTTTTGTTTTGTTTTTAGAAAAATAT
ATATAAATATATAATAGATATCTATCGCTATAGAATAATGCATTAATAAAATGAGGCTTT
TTTAGAGGAAGACCAAAAAATTCAATGTCTTAAAAATATATTTAATGGCAATGCAAAAGT
CTTCCTGCTTCCGTGCTGAACTTTAGAACAGAGGATTGTATTGCAAGACAAAGTTGAATG
TAAAGTGATCTCCCTGAACATTTTTAAGGTTTTACTTTTCTGAAATTATACATCACAGCA
GTGCATAGGCCATATAATGTTAGCTGGAAGGTCAATTTCAGTGTATGATATACTTTATTA
AGATGTATAAAAATCCTGAAGTTTTTATTTAGTTTTGGGAATAGGCATCAATGGGTGGTA
TTTGCTTTGTAACTCCCCCCAGGTACGATAGGGACTGAATATGGACCCTGCTGAAAGCAG
TGTATTGACGCATATTTAACTCGCCCTCTATCCGTAGAGTAGTCATGACACTATACAGAT
GGTTCGTGTTCATACTGCAGCTTAAAACAAGCAAAATACACAGATGATAATATGCTAAAT
TTTCCTCTATCCTGTACATTTCACAAAAAGGCATATGCAATATTTACATTTTTAATTTAG
TTTACAGAATGGAACCAAAATGTATAAATGTTATGTTTGCTAAAACTTCACAATGTATAT
TGGGTCTTTGTACATTTTGCCTGACTTACCTTAAATTTAAAATATTTTTTGCTATATAAA
CTTTAACAGTTATTAAACAGTGTTTTCTTTTTGGGTACGTATTGTTTCTGGATATCAAGA
TGTTAAATATATTTCTTGCTATTGTGATATGACAAGAGACTTAACTTATCTTGCTCTGTC
TTCCACTGTACACGCTGTATATAGGGGTCAATGTGATGCTGCTGGAGACGAGAATAAACT
GGACTAGAATAGTGCATTGTATTTAGTCTGTATTGATCATGGATGCCCTCCTTAATAGCC
ATATGCAATAAAATAAAGTACATTATTTATGAAATGAAAAAAAAAAAAAAAAAA

Protein Sequence

>8660 : length: 1338
MASPPRHGPPGPASGDGPNLNNNNNNNNHSVRKCGYLRKQKHGHKRFFVLRGPGAGGDEA
TAGGGSAPQPPRLEYYESEKKWRSKAGAPKRVIALDCCLNINKRADAKHKYLIALYTKDE
YFAVAAENEQEQEGWYRALTDLVSEGRAAAGDAPPAAAPAASCSASLPGALGGSAGAAGA
EDSYGLVAPATAAYREVWQVNLKPKGLGQSKNLTGVYRLCLSARTIGFVKLNCEQPSVTL
QLMNIRRCGHSDSFFFIEVGRSAVTGPGELWMQADDSVVAQNIHETILEAMKALKELFEF
RPRSKSQSSGSSATHPISVPGARRHHHLVNLPPSQTGLVRRSRTDSLAATPPAAKCSSCR
VRTASEGDGGAAAGAAAAGARPVSVAGSPLSPGPVRAPLSRSHTLSGGCGGRGSKVALLP
AGGALQHSRSMSMPVAHSPPAATSPGSLSSSSGHGSGSYPPPPGPHPPLPHPLHHGPGQR
PSSGSASASGSPSDPGFMSLDEYGSSPGDLRAFCSHRSNTPESIAETPPARDGGGGGEFY
GYMTMDRPLSHCGRSYRRVSGDAAQDLDRGLRKRTYSLTTPARQRPVPQPSSASLDEYTL
MRATFSGSAGRLCPSCPASSPKVAYHPYPEDYGDIEIGSHRSSSSNLGADDGYMPMTPGA
ALAGSGSGSCRSDDYMPMSPASVSAPKQILQPRAAAAAAAAVPSAGPAGPAPTSAAGRTF
PASGGGYKASSPAESSPEDSGYMRMWCGSKLSMEHADGKLLPNGDYLNVSPSDAVTTGTP
PDFFSAALHPGGEPLRGVPGCCYSSLPRSYKAPYTCGGDSDQYVLMSSPVGRILEEERLE
PQATPGPSQAASAFGAGPTQPPHPVVPSPVRPSGGRPEGFLGQRGRAVRPTRLSLEGLPS
LPSMHEYPLPPEPKSPGEYINIDFGEPGARLSPPAPPLLASAASSSSLLSASSPASSLGS
GTPGTSSDSRQRSPLSDYMNLDFSSPKSPKPGAPSGHPVGSLDGLLSPEASSPYPPLPPR
PSASPSSSLQPPPPPPAPGELYRLPPASAVATAQGPGAASSLSSDTGDNGDYTEMAFGVA
ATPPQPIAAPPKPEAARVASPTSGVKRLSLMEQVSGVEAFLQASQPPDPHRGAKVIRADP
QGGRRRHSSETFSSTTTVTPVSPSFAHNPKRHNSASVENVSLRKSSEGGVGVGPGGGDEP
PTSPRQLQPAPPLAPQGRPWTPGQPGGLVGCPGSGGSPMRRETSAGFQNGLNYIAIDVRE
EPGLPPQPQPPPPPLPQPGDKSSWGRTRSLGGLISAVGVGSTGGGCGGPGPGALPPANTY
ASIDFLSHHLKEATIVKE