ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

865

Name

CBFB

Synonym

PEBP2B;core-binding factor, beta subunit;CBFB;core-binding factor, beta subunit

Definition

CBF-beta|PEA2-beta|PEBP2-beta|SL3-3 enhancer factor 1 beta subunit|SL3-3 enhancer factor 1 subunit beta|SL3/AKV core-binding factor beta subunit|core-binding factor subunit beta|polyomavirus enhancer binding protein 2, beta subunit|polyomavirus enhancer-b

Position

16q22.1

Gene Type

protein-coding

Pathways and Diseases

Pathway

ATF-2 transcription factor network;PID Curated;200116

Pathway

AP-1 transcription factor network;PID Curated;200118

Pathway

Regulation of nuclear SMAD2/3 signaling;PID Curated;200002

Disease

Leukemia;FunDO

Disease

Stomach cancer;FunDO

Disease

Myeloid leukemia, acute, M4Eo subtype;OMIM

External Links

Links to cell senescence gene database

865

Links to epithelial mesenchymal transition gene database

865

Links to ovarian cancer gene database

865

Links to endometrial cancer gene database

865

Links to iHOP

865

Sequence Information

Nucleotide Sequence

>865 : length: 3181
GCGGTGAGCGCTGGGGCTGCGCGGGCGGCAGGCAACGGCTGAGGCGGCGGCGGCGGCGGC
GGCGGCGTGGGTTGGGCTCGAGCGGGCGGCGGCGCCTCAGACTCCCCGGAACGGGAGCCC
ACGCGGGCGGGCGCCTGAAACAAAGGGAAGCGGGCGTCCGGGCGCCGCGGGTGGGCGGTC
AGTCGGTCAGCGCGGAGCCAGCCAGCGGGTGCCCGCGCAAGCCCCGAGCGCGGCCGGCCG
GCGCGGCCTCAGGGCGGGAAGATGCCGCGCGTCGTGCCCGACCAGAGAAGCAAGTTCGAG
AACGAGGAGTTTTTTAGGAAGCTGAGCCGCGAGTGTGAGATTAAGTACACGGGCTTCAGG
GACCGGCCCCACGAGGAACGCCAGGCACGCTTCCAGAACGCCTGCCGCGACGGCCGCTCG
GAAATCGCTTTTGTGGCCACAGGAACCAATCTGTCTCTCCAGTTTTTTCCGGCCAGCTGG
CAGGGAGAACAGCGACAAACACCTAGCCGAGAGTATGTCGACTTAGAAAGAGAAGCAGGC
AAGGTATATTTGAAGGCTCCCATGATTCTGAATGGAGTCTGTGTTATCTGGAAAGGCTGG
ATTGATCTCCAAAGACTGGATGGTATGGGCTGTCTGGAGTTTGATGAGGAGCGAGCCCAG
CAGGAGGATGCATTAGCACAACAGGCCTTTGAAGAGGCTCGGAGAAGGACACGCGAATTT
GAAGATAGAGACAGGTCTCATCGGGAGGAAATGGAGGTGAGAGTTTCACAGCTGCTGGCA
GTAACTGGCAAGAAGACAACAAGACCCTAGTCCTGGTTCCAATTTAGGTGGTGGTGATGA
CCTCAAACTTCGTTAATTAATAGCACAGCAGATGTGTGCTGCCCATCTTTACATACACAT
TGCTTCTAGTTGGCAGAAATAATTGATTAAAAGACCAGAAACTGTGATAACTGGAGGTAC
TACGGTCTATTTCTCAACCTTAGGCAGTAATAGACATCACAAACTGCCATGGTTTTGCAC
TATGATTATAATACCTGCATTTCTAATTTTTTAAGCATGTAGCCAGTAATAATTTGAAGT
TTTTTTTCTATGCAAGCTTACCTTGTTGGCATTATTTTAGGGAGTTGAAACTATCAACTG
TAAAGCTCCTTTTCTTCCACTTTAATTTAAAAGTTCATGTCATTTAAAAACAAGTCAAGA
AATTAAAATTGTATCAGAGGGTTTTCTCTAATCATTTTTTCTATTTTTTTTTTTGTACTT
CTAGATGTTTTGGTTATACAGCTTCATTTTAGATGAGCATTCTTATTTTTTGTTTTGTTT
GCCCCATTTCCTTTTGTGTTTTTATAGTCTATAGCATTTTAAAACTGCTGATGTTGTTTG
CATTATTTACAGGCTAAAAACTTAGTAGCATAGAGCTGTCTGCCACAGCCTTCTGACAAA
GTTTACAGTTATTAAAGTTGCAGTATCCTTTTAAATGCTAGTAATCAGCACTCTTTCTTT
TTTTTTTTTTTAATAGAGACAGGGTCTCGCAGTGTTGCCCAGGCTGGTCTCGAACTCCTG
GCATCAAGCGATCCTCCTGCCTTAGCCTCCCAGAGTACTGGGATTACAGGCTCTTTCTTT
TTAAACATAAAAGTTTTAAATTGGTATTAACTCTGTACTCTGCCCTAGATTGTTTTAGCT
TCTGTTCTGTAATCATGAGTTTGGTTGGAGATATTCTCCATAGATGATCTTCTACTGAAA
TGCCTAAAGAAGTCACAGGCTGGCTTCTGTTTTATTCAGGGATTTTTTTAAAAAGTCAAT
CAGAAAAGGGATACTGGAGCTTCTTCATGTATGTAACAGCATATTAAACTGGAGACAGTG
ATGAATCAGCTACAAAGGTAATATTGTATTAAAATCATGTTTAAGATAGCTGCTTTTATG
TGTATTTTATATTGCATGCTTTTGTAAAAACATGCTGGGTGATGAAAGATTAGTTTTAGA
GAGAAAATGTTCATCTGTGCAGAGGATGCATTTTCTTCCATTAATTCTGGAAAAAACGTT
CACAGTTATATATATGGTATTTTGCAAAAGGACTATTAATAGAACCTTTTGAGATGAATT
AATGTAAGAATATTTTTTAAATAGGCTTACTGTCAAATTGCAACTTTTTTTTTAGATACA
GAGTGGAAAACAGTGCTAAGTCATTTGGCACCTCCTTACAAATATTTTTCATGGTCACAT
TTATTAAATGTTACTACATTTCTGAATTTTTGAAAAATGTATTTTATCATTAAATGGCAT
TATTTTAAAGGGTGAAAAACTGACACAGTCAATTCAGAAAATGGACTGAAGTCTGAATAA
GGTCATTGCATTTAAAAAGCATATAACTGTACTTGACTGATGAGGGAGGTGTTACTTTCA
TTGTATATAGGTCTTATTTCATAAACAGATATCCTGTATCAAATAAAAGTATTTGTTATA
TATTTGAAGTTATGCATGGAAAGGAGTGTGTTTAAATTGTTACAAACAATAATGCGTCAT
TAAAGGCCATGCTGATCTTGCATAACTATAAGTACTATGAATGAATTTGGTTGGTTTTGG
TGTTGTACAGCTCACATGTTTACACACTCAGTGCCCTAATTTCCCCTGAGGGAATCGCTT
TTTAAGTGATCCTTACAGTGGTGTTTTATGTTACTTTATTACAGAGCTCCTTGGTTTTTT
ACTTCTGCACTTAAATTTTTTTAAATAACATGATGATGGTACATTTTCCTCTATTGTCTA
GCTAAGGGCTTTCGGTCCACCAGTAAATAAGATCAAATGCTCTTAAATGTTCCTGTTACC
ATCCTAATGTAAATACTGGATTTTTCTGTCATTTAGCACCATGCTGCTTCTGTCTGTCTT
AATGCTGGCATTAAGATCATGAGCCCTTTTTCTCCAGTAGTACAGGCTTTGAAAACTACT
TCTATTAAGTTATTGATGCAATTTGATATTTTTTCATAATCTATATTTAAACAAAATTAC
ATCATTGCATCATCTTTTCTAAATTCATCTCCATTAAAACTTGCCTTAAGCTACCAGATT
GCTTTTGCCACCATTGGCCATACTGTGTGTTTGTTTGTTTAATTTACTTTCACAATAAAC
TTCTGTGTAGTAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
A

Protein Sequence

>865 : length: 187
MPRVVPDQRSKFENEEFFRKLSRECEIKYTGFRDRPHEERQARFQNACRDGRSEIAFVAT
GTNLSLQFFPASWQGEQRQTPSREYVDLEREAGKVYLKAPMILNGVCVIWKGWIDLQRLD
GMGCLEFDEERAQQEDALAQQAFEEARRRTREFEDRDRSHREEMEARRQQDPSPGSNLGG
GDDLKLR