ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

8643

Name

PTCH2

Synonym

PTC2;patched 2;PTCH2;patched 2

Definition

patched homolog 2|protein patched homolog 2

Position

1p34.1

Gene Type

protein-coding

Pathways and Diseases

Pathway

Signaling by GPCR;Reactome;REACT:14797

Pathway

Signaling events mediated by the Hedgehog family;PID Curated;200144

Pathway

Pathways in cancer;KEGG PATHWAY;hsa05200

Pathway

Basal cell carcinoma;KEGG PATHWAY;hsa05217

Pathway

Hedgehog signaling pathway;KEGG PATHWAY;hsa04340

Disease

Basal cell carcinoma, somatic;OMIM

Disease

Medulloblastoma;OMIM

External Links

Links to cell senescence gene database

8643

Links to epithelial mesenchymal transition gene database

8643

Links to ovarian cancer gene database

8643

Links to endometrial cancer gene database

8643

Links to iHOP

8643

Sequence Information

Nucleotide Sequence

>8643 : length: 4298
ATCCCCGCCAGCATGACTCGATCGCCGCCCCTCAGAGAGCTGCCCCCGAGTTACACACCC
CCAGCTCGAACCGCAGCACCCCAGATCCTAGCTGGGAGCCTGAAGGCTCCACTCTGGCTT
CGTGCTTACTTCCAGGGCCTGCTCTTCTCTCTGGGATGCGGGATCCAGAGACATTGTGGC
AAAGTGCTCTTTCTGGGACTGTTGGCCTTTGGGGCCCTGGCATTAGGTCTCCGCATGGCC
ATTATTGAGACAAACTTGGAACAGCTCTGGGTAGAAGTGGGCAGCCGGGTGAGCCAGGAG
CTGCATTACACCAAGGAGAAGCTGGGGGAGGAGGCTGCATACACCTCTCAGATGCTGATA
CAGACCGCACGCCAGGAGGGAGAGAACATCCTCACACCCGAAGCACTTGGCCTCCACCTC
CAGGCAGCCCTCACTGCCAGTAAAGTCCAAGTATCACTCTATGGGAAGTCCTGGGATTTG
AACAAAATCTGCTACAAGTCAGGAGTTCCCCTTATTGAAAATGGAATGATTGAGCGGATG
ATTGAGAAGCTGTTTCCGTGCGTGATCCTCACCCCCCTCGACTGCTTCTGGGAGGGAGCC
AAACTCCAAGGGGGCTCCGCCTACCTGCCCGGCCGCCCGGATATCCAGTGGACCAACCTG
GATCCAGAGCAGCTGCTGGAGGAGCTGGGTCCCTTTGCCTCCCTTGAGGGCTTCCGGGAG
CTGCTAGACAAGGCACAGGTGGGCCAGGCCTACGTGGGGCGGCCCTGTCTGCACCCTGAT
GACCTCCACTGCCCACCTAGTGCCCCCAACCATCACAGCAGGCAGGCTCCCAATGTGGCT
CACGAGCTGAGTGGGGGCTGCCATGGCTTCTCCCACAAATTCATGCACTGGCAGGAGGAA
TTGCTGCTGGGAGGCATGGCCAGAGACCCCCAAGGAGAGCTGCTGAGGGCAGAGGCCCTG
CAGAGCACCTTCTTGCTGATGAGTCCCCGCCAGCTGTACGAGCATTTCCGGGGTGACTAT
CAGACACATGACATTGGCTGGAGTGAGGAGCAGGCCAGCACAGTGCTACAAGCCTGGCAG
CGGCGCTTTGTGCAGCTGGCCCAGGAGGCCCTGCCTGAGAACGCTTCCCAGCAGATCCAT
GCCTTCTCCTCCACCACCCTGGATGACATCCTGCATGCGTTCTCTGAAGTCAGTGCTGCC
CGTGTGGTGGGAGGCTATCTGCTCATGCTGGCCTATGCCTGTGTGACCATGCTGCGGTGG
GACTGCGCCCAGTCCCAGGGTTCCGTGGGCCTTGCCGGGGTACTGCTGGTGGCCCTGGCG
GTGGCCTCAGGCCTTGGGCTCTGTGCCCTGCTCGGCATCACCTTCAATGCTGCCACTACC
CAGGTGCTGCCCTTCTTGGCTCTGGGAATCGGCGTGGATGACGTATTCCTGCTGGCGCAT
GCCTTCACAGAGGCTCTGCCTGGCACCCCTCTCCAGGAGCGCATGGGCGAGTGTCTGCAG
CGCACGGGCACCAGTGTCGTACTCACATCCATCAACAACATGGCCGCCTTCCTCATGGCT
GCCCTCGTTCCCATCCCTGCGCTGCGAGCCTTCTCCCTACAGGCGGCCATAGTGGTTGGC
TGCACCTTTGTAGCCGTGATGCTTGTCTTCCCAGCCATCCTCAGCCTGGACCTACGGCGG
CGCCACTGCCAGCGCCTTGATGTGCTCTGCTGCTTCTCCAGTCCCTGCTCTGCTCAGGTG
ATTCAGATCCTGCCCCAGGAGCTGGGGGACGGGACAGTACCAGTGGGCATTGCCCACCTC
ACTGCCACAGTTCAAGCCTTTACCCACTGTGAAGCCAGCAGCCAGCATGTGGTCACCATC
CTGCCTCCCCAAGCCCACCTGGTGCCCCCACCTTCTGACCCACTGGGCTCTGAGCTCTTC
AGCCCTGGAGGGTCCACACGGGACCTTCTAGGCCAGGAGGAGGAGACAAGGCAGAAGGCA
GCCTGCAAGTCCCTGCCCTGTGCCCGCTGGAATCTTGCCCATTTCGCCCGCTATCAGTTT
GCCCCGTTGCTGCTCCAGTCACATGCTAAGGCCATCGTGCTGGTGCTCTTTGGTGCTCTT
CTGGGCCTGAGCCTCTACGGAGCCACCTTGGTGCAAGACGGCCTGGCCCTGACGGATGTG
GTGCCTCGGGGCACCAAGGAGCATGCCTTCCTGAGCGCCCAGCTCAGGTACTTCTCCCTG
TACGAGGTGGCCCTGGTGACCCAGGGTGGCTTTGACTACGCCCACTCCCAACGCGCCCTC
TTTGATCTGCACCAGCGCTTCAGTTCCCTCAAGGCGGTGCTGCCCCCACCGGCCACCCAG
GCACCCCGCACCTGGCTGCACTATTACCGCAACTGGCTACAGGGAATCCAGGCTGCCTTT
GACCAGGACTGGGCTTCTGGGCGCATCACCCGCCACTCGTACCGCAATGGCTCTGAGGAT
GGGGCCCTGGCCTACAAGCTGCTCATCCAGACTGGAGACGCCCAGGAGCCTCTGGATTTC
AGCCAGCTGACCACAAGGAAGCTGGTGGACAGAGAGGGACTGATTCCACCCGAGCTCTTC
TACATGGGGCTGACCGTGTGGGTGAGCAGTGACCCCCTGGGTCTGGCAGCCTCACAGGCC
AACTTCTACCCCCCACCTCCTGAATGGCTGCACGACAAATACGACACCACGGGGGAGAAC
CTTCGCATCCCGCCAGCTCAGCCCTTGGAGTTTGCCCAGTTCCCCTTCCTGCTGCGTGGC
CTCCAGAAGACTGCAGACTTTGTGGAGGCCATCGAGGGGGCCCGGGCAGCATGCGCAGAG
GCCGGCCAGGCTGGGGTGCACGCCTACCCCAGCGGCTCCCCCTTCCTCTTCTGGGAACAG
TATCTGGGCCTGCGGCGCTGCTTCCTGCTGGCCGTCTGCATCCTGCTGGTGTGCACTTTC
CTCGTCTGTGCTCTGCTGCTCCTCAACCCCTGGACGGCTGGCCTCATAGTGCTGGTCCTG
GCGATGATGACAGTGGAACTCTTTGGTATCATGGGTTTCCTGGGCATCAAGCTGAGTGCC
ATCCCCGTGGTGATCCTTGTGGCCTCTGTAGGCATTGGCGTTGAGTTCACAGTCCACGTG
GCTCTGGGCTTCCTGACCACCCAGGGCAGCCGGAACCTGCGGGCCGCCCATGCCCTTGAG
CACACATTTGCCCCCGTGACCGATGGGGCCATCTCCACATTGCTGGGTCTGCTCATGCTT
GCTGGTTCCCACTTTGACTTCATTGTAAGGTACTTCTTTGCGGCGCTGACAGTGCTCACG
CTCCTGGGCCTCCTCCATGGACTCGTGCTGCTGCCTGTGCTGCTGTCCATCCTGGGCCCG
CCGCCAGAGGTGATACAGATGTACAAGGAAAGCCCAGAGATCCTGAGTCCACCAGCTCCA
CAGGGAGGCGGGCTTAGGCCCGAGGAGATCTAGCCTCTGCCTCCCACCCCAGCACCCCCT
CATCAGACACACGGAGCGCCACTGTCTGGACAGGCTGAATTGGTCTTCGGGTCCCTAATT
TCTCATACGCCATTCCCTCTGCCTAGAACACTTTCTCACCTCCCCTTGATGTGACCCCAT
ATCACCCTTCGAGGTGAATTGGATCGGATGCCATCTCCTCCAGGAGGGGTGGGGTCGTGC
CTCCTGTGAGGTCCCAGTGCCCCTGAGTGTCTGTGCCCGTCTGTTTCCCCGTCCCTCTCT
CTAAGCCCGGAGGCTTACTGCGGGTAAGGACGGCGGGACAGGACCTTAACCCCTGGGACG
AACACCAGCTCCGCAAAGGACTCCGCACCCGGCGCCGCCCACGGGGTGCGGGTCCCAGGA
GGACCAGCAGAGAGGAGCATAGGAGAGCAAAGGAGATCAGTGACCCATGGCTTCCCCGGT
GGCGCGGAACAGCCCGGAGCCGCCTGTGATTTGCATACCCATGGTGCACCACGAAAAGAT
ACCCTCAAGATGCTTGCACTCCCTCTGTGCGCGCATTTCTGCACTGTTTTAGAGCATGAT
GCCTCTTACACGCATCTGTGTGCATAAACTACATATAGGGAGTGCGTACCACGCAGGCAT
CCAACAACCATAAGTGTGTTAAGTGTTAGTTCTCCCTGCGAGGTTCGAAGCGGAAGTCAC
GAATATACTCGGGTTTCTCTTCAAAGCGCATAAATCTTTCGCCTTTTACTAAAGATTTCC
GTGGAGAGAAAGTTGTGAGTTTTTATTCAATTTTTTGAGGCCTCTTATTTCCTGAGGCTA
CATTTTTAAGTATTAAAAGTTAGGCAACTACAACCAAG

Protein Sequence

>8643 : length: 1203
MTRSPPLRELPPSYTPPARTAAPQILAGSLKAPLWLRAYFQGLLFSLGCGIQRHCGKVLF
LGLLAFGALALGLRMAIIETNLEQLWVEVGSRVSQELHYTKEKLGEEAAYTSQMLIQTAR
QEGENILTPEALGLHLQAALTASKVQVSLYGKSWDLNKICYKSGVPLIENGMIERMIEKL
FPCVILTPLDCFWEGAKLQGGSAYLPGRPDIQWTNLDPEQLLEELGPFASLEGFRELLDK
AQVGQAYVGRPCLHPDDLHCPPSAPNHHSRQAPNVAHELSGGCHGFSHKFMHWQEELLLG
GMARDPQGELLRAEALQSTFLLMSPRQLYEHFRGDYQTHDIGWSEEQASTVLQAWQRRFV
QLAQEALPENASQQIHAFSSTTLDDILHAFSEVSAARVVGGYLLMLAYACVTMLRWDCAQ
SQGSVGLAGVLLVALAVASGLGLCALLGITFNAATTQVLPFLALGIGVDDVFLLAHAFTE
ALPGTPLQERMGECLQRTGTSVVLTSINNMAAFLMAALVPIPALRAFSLQAAIVVGCTFV
AVMLVFPAILSLDLRRRHCQRLDVLCCFSSPCSAQVIQILPQELGDGTVPVGIAHLTATV
QAFTHCEASSQHVVTILPPQAHLVPPPSDPLGSELFSPGGSTRDLLGQEEETRQKAACKS
LPCARWNLAHFARYQFAPLLLQSHAKAIVLVLFGALLGLSLYGATLVQDGLALTDVVPRG
TKEHAFLSAQLRYFSLYEVALVTQGGFDYAHSQRALFDLHQRFSSLKAVLPPPATQAPRT
WLHYYRNWLQGIQAAFDQDWASGRITRHSYRNGSEDGALAYKLLIQTGDAQEPLDFSQLT
TRKLVDREGLIPPELFYMGLTVWVSSDPLGLAASQANFYPPPPEWLHDKYDTTGENLRIP
PAQPLEFAQFPFLLRGLQKTADFVEAIEGARAACAEAGQAGVHAYPSGSPFLFWEQYLGL
RRCFLLAVCILLVCTFLVCALLLLNPWTAGLIVLVLAMMTVELFGIMGFLGIKLSAIPVV
ILVASVGIGVEFTVHVALGFLTTQGSRNLRAAHALEHTFAPVTDGAISTLLGLLMLAGSH
FDFIVRYFFAALTVLTLLGLLHGLVLLPVLLSILGPPPEVIQMYKESPEILSPPAPQGGG
LRWGASSSLPQSFARVTTSMTVAIHPPPLPGAYIHPAPDEPPWSPAATSSGNLSSRGPGP
ATG