ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

864

Name

RUNX3

Synonym

AML2|CBFA3|PEBP2aC;runt-related transcription factor 3;RUNX3;runt-related transcription factor 3

Definition

CBF-alpha-3|PEA2 alpha C|PEA2-alpha C|PEBP2 alpha C|PEBP2-alpha C|SL3-3 enhancer factor 1 alpha C subunit|SL3/AKV core-binding factor alpha C subunit|acute myeloid leukemia 2 protein|acute myeloid leukemia gene 2|core-binding factor subunit alpha-3|core-b

Position

1p36

Gene Type

protein-coding

External Links

Links to cell senescence gene database

864

Links to epithelial mesenchymal transition gene database

864

Links to ovarian cancer gene database

864

Links to endometrial cancer gene database

864

Links to iHOP

864

Sequence Information

Nucleotide Sequence

>864 : length: 4340
ATTCATTCATTCCCCGTGGCACTGGAGGCGGCCCACTCTGCTCTGTCAGCTTCGGAGCTC
CTCCACCCTGGCTGCCGAAAGCCCCTTCCCGCCATCTAATGATACACTCTGCATACGCTT
CTGTTGAGAATTTGTGGCTAGACATTCCTGTGGGACCGGGAATCCAAATTCTTGGGTACA
AACAGAAACTTACTTTCCTTGGGGATTTTTTTCTCTCTCTCACTCACACACACTCTCGCG
TTCTTTCCTTTTTTCTTTTTCGTAGCAGCAGGGGGGAAAAAAGAGACAAAAACAAAACAA
AAAACAACAAAAAGCAACACCCCCCCCTTTTATTTTCAAAAGTAGCTAGAGGAAAAAAAA
ATAAAACAACAGCCAACCAAGTGAATCCCAACCCAACCCCCTGAAGGGCTGAAAATTCTC
GCCTTCTTCAGAGCGGGGCATGGCATCGAACAGCATCTTCGACTCCTTCCCGACCTACTC
GCCGACCTTCATCCGCGACCCAAGCACCAGCCGCCGCTTCACACCTCCCTCCCCGGCCTT
CCCCTGCGGCGGCGGCGGCGGCAAGATGGGCGAGAACAGCGGCGCGCTGAGCGCGCAGGC
GGCCGTGGGGCCCGGAGGGCGCGCCCGGCCCGAGGTGCGCTCGATGGTGGACGTGCTGGC
GGACCACGCAGGCGAGCTCGTGCGCACCGACAGCCCCAACTTCCTCTGCTCCGTGCTGCC
CTCGCACTGGCGCTGCAACAAGACGCTGCCCGTCGCCTTCAAGGTGGTGGCATTGGGGGA
CGTGCCGGATGGTACGGTGGTGACTGTGATGGCAGGCAATGACGAGAACTACTCCGCTGA
GCTGCGCAATGCCTCGGCCGTCATGAAGAACCAGGTGGCCAGGTTCAACGACCTTCGCTT
CGTGGGCCGCAGTGGGCGAGGGAAGAGTTTCACCCTGACCATCACTGTGTTCACCAACCC
CACCCAAGTGGCGACCTACCACCGAGCCATCAAGGTGACCGTGGACGGACCCCGGGAGCC
CAGACGGCACCGGCAGAAGCTGGAGGACCAGACCAAGCCGTTCCCTGACCGCTTTGGGGA
CCTGGAACGGCTGCGCATGCGGGTGACACCGAGCACACCCAGCCCCCGAGGCTCACTCAG
CACCACAAGCCACTTCAGCAGCCAGCCCCAGACCCCAATCCAAGGCACCTCGGAACTGAA
CCCATTCTCCGACCCCCGCCAGTTTGACCGCTCCTTCCCCACGCTGCCAACCCTCACGGA
GAGCCGCTTCCCAGACCCCAGGATGCATTATCCCGGGGCCATGTCAGCTGCCTTCCCCTA
CAGCGCCACGCCCTCGGGCACGAGCATCAGCAGCCTCAGCGTGGCGGGCATGCCGGCCAC
CAGCCGCTTCCACCATACCTACCTCCCGCCACCCTACCCGGGGGCCCCGCAGAACCAGAG
CGGGCCCTTCCAGGCCAACCCGTCCCCCTACCACCTCTACTACGGGACATCCTCTGGCTC
CTACCAGTTCTCCATGGTGGCCGGCAGCAGCAGTGGGGGCGACCGCTCACCTACCCGCAT
GCTGGCCTCTTGCACCAGCAGCGCTGCCTCTGTCGCCGCCGGCAACCTCATGAACCCCAG
CCTGGGCGGCCAGAGTGATGGCGTGGAGGCCGACGGCAGCCACAGCAACTCACCCACGGC
CCTGAGCACGCCAGGCCGCATGGATGAGGCCGTGTGGCGGCCCTACTGACCGCCCTGGTG
GACTCCTCCCGCTGGAGGCGGGGACCCTAACAACCTTCAAGACCAGTGATGGGCCGGCTC
CGAGGCTCCGGGCGGGAATGGGACCTGCGCTCCAGGGTGGTCTCGGTCCCAGGGTGGTCC
CAGCTGGTGGGAGCCTCTGGCTGCATCTGTGCAGCCACATCCTTGTACAGAGGCATAGGT
TACCACCCCCACCCCGGCCCGGGATACTGCCCCCGGCCCAGATCCTGGCCGTCTCATCCC
ATACTTCTGTGGGGAATCAGCCTCCTGCCACCCCCCCGGAAGGACCTCACTGTCTCCAGC
TATGCCCAGTGCTGCATGGGACCCATGTCTCCTGGGACAGAGGCCATCTCTCTTCCAGAG
AGAGGCAGCATTGGCCCACAGGATAAGCCTCAGGCCCTGGGAAACCTCCCGACCCCTGCA
CCTTCGTTGGAGCCCCTGCATCCCCTGGGTCCAGCCCCCTCTGCATTTACACAGATTTGA
GTCAGAACTGGAAAGTGTCCCCCACCCCCACCACCCTCGAGCGGGGTTCCCCTCATTGTA
CAGATGGGGCAGGACCCAGCACGCTGCTGGCAGAGATGGTTTGAGAACACATCCAAGCCA
GTCCCCCCAGCCCAGCTTCCCCTCCGTTCCTAACTGTTGGCTTTCCCCCAGCCGCACGGG
TCCCAGGCCCCAGAGAAGATGAGTCTATGGCATCAGGTTCTTAAACCCAGGAAAGCACCT
ACAGACCGGCTCCTCCATGCACTTTACCAGCTCAACGCATCCACTCTCTGTTCTCTTGGC
AGGGCGGGGGAGGGGGGATAGGAGGTCCCCTTTCCCCTAGGTGGTCTCATAATTCCATTT
GTGGAGAGAACAGGAGGGCCAGATAGATAGGTCCTAGCAGAAGGCATTGAGGTGAGGGAT
CATTTTGGGTCAGACATCAATGTCCCTGTCCCCCCTGGGTCCAGCCAAGCTGTGCCCCAT
CCCCCAAGCCTCCTGGGAGGATCCAGCCAAATCTTGCGACTCCTGGCACACACCTGTCTG
TAACCTGTTTTGTGCTCTGAAAGCAAATAGTCCTGAGCAAAAAAAAAAAAAAAACAAAAA
AACAAAAAAAAAACAAAACAGTTTTTAAAACTGATTTTAGAAAAAGAAGCTTAATCTAAC
GTTTTCAAACACAAGGTCTCTTACAGGTATAGTTCCGTGATTATGATAGCTCTGTGATTA
TAAGCAACATCCCCGCCCCCTCTCCCCCCCGCGGACCCCCAGCTGCCTCCTGAGGGTGTG
GGGTTATTAGGGTCTCAATACTTTCTCAAGGGGCTACACTCCCCATCAGGCAGCATCCCA
CCAGCCTGCACCACAGGCTCCCCTGGGAGGACGAGGGAAACGCTGATGAGACGCTGGGCA
TCTCTCCTCTGTGGCTCTAGGACATCTGTCCAGGAGGCTGGGCGGAGGTGGGCAGGATGT
GAGAGGTGGGGAGTACTGGCTGTGCGTGGCAGGACAGAAGCACTGTAAAGGGCTCTCCAG
CCGCAGCTCAGCTGCACTGCGTTCCGAGGTGAAGTCTTGCCCCTGAATTTTGCAAAATGG
GAAAGTGGGCGCTTGCCCAAGGGCCAGGCTGCATGGATTCTCACATCAGAGTTCTCTGGC
CCTAGAAAGGCTTAGAAAAGGCGTAAGGGAACTCATAAAGGCTAGCAGCATGCGGTATTT
TAACTTTCTGCCTCGGCCTCTGTGGATGCAGAAATCTGCCCTACAAAATGCTCTTCATTG
GTTGTCTCTGTGAGAGCACTGTCCCCACCCAACCTGTCACAACGGCCAGAACCATACACC
AGAGACACACTGGCAGGTTAGGCAGTCCTTCTGGTGATCCTATTCCATTCCCTCCTGCTG
CGGTTTCTCTTGGCCTGTCCTCACTGGAAAAACAGTCTCCATCTCCTCAAAATAGTTGCT
GACTCCCTGCACCCAAGGGGCCTCTCCATGCCTTCTTAGGAAGCAGCTATGAATCCATTG
TCCTTGTAGTTTCTTCCCTCCTGTTCTCTGGTTATAGCTGGTCCCAGGTCAGCGTGGGAG
GCACCTTTGGGTTCCCAGTGCCCAGCACTTTGTAGTCTCATCCCAGATTACTAACCCTTC
CTGATCCTGGAGAGGCAGGGATAGTAAATAAATTGCTCTTCCTACCCCATCCCCCATCCC
CTGACAAAAAGTGACGGCAGCCGTACTGAGTCTGTAAGGCCCAAAGTGGGTACAGACAGC
CTGGGCTGGTAAAAGTAGGTCCTTATTTACAAGGCTGCGTTAAAGTTGTACTAGGCAAAC
ACACTGATGTAGGAAGCACGAGGAAAGGAAGACGTTTTGATATAGTGTTACTGTGAGCCT
GTCAGTAGTGGGTACCAATCTTTTGTGACATATTGTCATGCTGAGGTGTGACACCTGCTG
CACTCATCTGATGTAAAACCATCCCAGAGCTGGCGAGAGGATGGAGCTGGGTGGAAACTG
CTTTGCACTATCGTTTGCTTGGTGTTTGTTTTTAACGCACAACTTGCTTGTACAGTAAAC
TGTCTTCTGTACTATTTAACTGTAAAATGGAATTTTGACTGATTTGTTACAATAATATAA
CTCTGAGATGTGTGGAAGGA

Protein Sequence

>864 : length: 429
MASNSIFDSFPTYSPTFIRDPSTSRRFTPPSPAFPCGGGGGKMGENSGALSAQAAVGPGG
RARPEVRSMVDVLADHAGELVRTDSPNFLCSVLPSHWRCNKTLPVAFKVVALGDVPDGTV
VTVMAGNDENYSAELRNASAVMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPTQVATY
HRAIKVTVDGPREPRRHRQKLEDQTKPFPDRFGDLERLRMRVTPSTPSPRGSLSTTSHFS
SQPQTPIQGTSELNPFSDPRQFDRSFPTLPTLTESRFPDPRMHYPGAMSAAFPYSATPSG
TSISSLSVAGMPATSRFHHTYLPPPYPGAPQNQSGPFQANPSPYHLYYGTSSGSYQFSMV
AGSSSGGDRSPTRMLASCTSSAASVAAGNLMNPSLGGQSDGVEADGSHSNSPTALSTPGR
MDEAVWRPY